KEGG   Vibrio sp. EJY3: VEJY3_24246Help
Entry
VEJY3_24246       CDS       T01683                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vej  Vibrio sp. EJY3
Brite
KEGG Orthology (KO) [BR:vej00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VEJY3_24246
Enzymes [BR:vej01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     VEJY3_24246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 Glutaredoxin HI0933_like Thioredoxin_9 FAD_binding_3 DAO Chalcone_N Thi4 NAD_binding_8 DUF5474
Motif
Other DBs
NCBI-ProteinID: AEX25258
LinkDB All DBs
Position
2:1937126..1938718
Genome map
AA seq 530 aa AA seqDB search
MLDQAIQQQLKQYLANVKEDVRLVVSLDESKAANDILSLANQIAEMSEHISVVRDDAASD
RKPVMAVTNPTKGTALSFAGLPMGHEFTSLVLALLHSGGHPIKLEPEVIEQIAALDKELD
VEIFISLSCQNCPDVVQAFNMMAAINPKVKTTMIDGALFQDEVKHRDIMAVPSVFVNGEL
FGQGRMSLTEILNKVDDSASEKAAKALDEKEPYDVLVVGGGPGGSAAALYAARKGIRTGV
VAKRFGGQVMDTMAIENFVSVKRTEGPKLAADLGEHLKEYDVDVVTEQQAKKLMGAAHTE
DGLIHIQLESGATLKSQSVILSPGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADVLRADQVLINKANSLPNVDIITMAQTTEVVG
DGKRVTGLKYKDRNTDEIKELELSGIFVQIGLVPNTEWLKDSDVNLSPRGEIEVGSHGET
SLEGVFAAGDATTVPYKQIIIAMGEGAKASLGAFDYLIRKQGLSPELLEQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaagcgatccaacaacaactcaaacaatatctggctaatgtaaaagaagac
gtacgtctagtggttagcctagatgaaagcaaagcggcaaatgatattttgtctctcgct
aatcaaatcgcagaaatgagcgagcatatttctgttgttcgtgacgacgcagccagtgac
cgtaaaccagtaatggcggtaaccaacccgactaaaggaacagcacttagctttgctggc
ctgcctatgggccatgaatttacgtcactagtgcttgctctgcttcactctggcggtcac
ccaatcaagctagagccagaagtgattgaacaaatcgctgcgctagacaaagaattggat
gtagaaatctttatttctctgtcttgtcagaactgcccggacgtcgtgcaagcgttcaac
atgatggcagcgattaacccgaaagtgaaaacaaccatgatcgacggtgctttgttccaa
gacgaagtgaaacatcgcgatatcatggcagtaccaagtgtattcgttaacggtgagctg
ttcggccaaggccgcatgtctcttacagaaattctgaacaaagtcgacgacagcgcaagc
gagaaagcagccaaagcactggatgaaaaagaaccgtacgacgtactcgttgtaggtggc
ggccctggtggtagtgcagcagcgctttacgcagcacgtaaaggcatccgcactggtgtt
gtggctaaacgttttggtggtcaggttatggacaccatggcgatcgaaaactttgtctcg
gtgaaacgcactgaaggtcctaagctggcggctgatcttggcgagcatttgaaagagtac
gacgttgacgttgtgacagagcagcaagctaaaaagctaatgggtgcagcacatactgaa
gatggtcttatccatattcagctagaaagcggcgcaacacttaagagtcagagtgtcatt
ctgagcccaggtgcacgctggcgtgaaatgaatgttcctggtgagcaagagtaccgcaat
aaaggcgttgcttactgtccacactgtgatggtccgctattcaaaggtaaaaagacggcc
gttatcggcggtggtaactcaggtatcgaagcggcaatcgaccttgcaggtattgtggaa
catgtaacggttcttgaatttgctgatgttttacgtgctgaccaagtactgatcaacaaa
gcgaactcgctaccaaacgtcgacatcattaccatggcacaaacaacggaagttgtaggt
gacggcaagcgcgtgactggcctgaaatacaaagaccgcaacacagatgaaatcaaagaa
cttgagctatcgggtatcttcgttcaaatcggtcttgttcctaacacagagtggctgaaa
gattcagatgtgaacttgtctccacgtggtgaaattgaagtaggcagtcacggtgaaacc
agcctggaaggtgtatttgctgcgggtgacgcaacaacggtaccttacaaacagatcatc
attgcgatgggtgaaggtgcaaaagcaagcttaggcgcgtttgactacctgattcgtaag
caaggtttatctccagaacttctggaacaataa

DBGET integrated database retrieval system