KEGG   Vollenhovia emeryi: 105558132
Entry
105558132         CDS       T06016                                 

Definition
(RefSeq) uncharacterized protein LOC105558132
  KO
K16679  wengen
Organism
vem  Vollenhovia emeryi
Pathway
vem04013  MAPK signaling pathway - fly
vem04214  Apoptosis - fly
vem04215  Apoptosis - multiple species
vem04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:vem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105558132
   04391 Hippo signaling pathway - fly
    105558132
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105558132
   04215 Apoptosis - multiple species
    105558132
SSDB
Motif
Pfam: Trp_oprn_chp TNFR_c6 HCO3_cotransp Bac_luciferase
Other DBs
NCBI-GeneID: 105558132
NCBI-ProteinID: XP_011861047
LinkDB
Position
Unknown
AA seq 362 aa
MPRESCPGLLLTLVSVFVGLCESSAAGRTATSDAQQPQPQPPQQQPQPRSQQQYPVCESG
LEFWSAERASCWPCTRCAPEFTLSPCVIHKDAICGPLSALELDWSFLSSTARKRSSRAGD
DDGTVTPNVIPRFPEEKTKEGSFTQADNLVNLDCEDNGSGKESVLTAQESKTAHDPRDRR
KSVAEDNLPWDWQTGALVLAVCACILFFMVAGCSALVYARQWRRMKRNFEPAGLEEISAR
LNLMVKAELAELVAGAPMNPGDPETRCQYLEKLLDRKRETPVVTAAAATATTTITTTTTT
TTTTTMTTTTTAATAATAAAAGNLYIEEGGTMTPRSKRSQIARIQRNIETILSHKTSEVD
RD
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgccgagggaatcttgtcccgggttgctgttgactctggtgtcggtattcgtcggtctg
tgcgagtcctccgccgccggcagaaccgcgacttccgacgcccagcagccacaaccgcag
ccgccgcagcagcagccgcagccacggtcgcagcaacaatatccggtttgcgagtccggc
ctggagttctggtctgccgagcgcgcctcatgctggccatgcacccgatgcgcccccgag
ttcaccttgagcccctgcgtgattcacaaggatgcgatatgcggtccgctgtcggcgctt
gagctcgactggtccttcctgtcgtcaacggccaggaagagatcctcgcgagccggtgat
gacgacggcaccgtcaccccgaacgtgatcccacggttccccgaagaaaagacgaaagaa
gggtccttcacgcaagccgataatctcgtcaacctcgattgcgaggacaacggaagcggc
aaagagtcggtcctcaccgcgcaggaatcaaaaacggcacacgatccccgtgacaggaga
aaatcggtcgccgaggacaatctaccgtgggactggcagactggcgctttggtcctcgcg
gtatgcgcctgcatactattcttcatggtggcgggctgctcggctctcgtctacgcgagg
cagtggcggcgaatgaagaggaactttgagccagcgggactcgaggagatctcggccagg
ttgaacctgatggtgaaggcggagctggccgagctggttgccggtgcaccaatgaaccca
ggtgatcccgagaccagatgtcagtatctcgaaaagcttttagaccggaaacgagagacg
ccggtggtgacggcggcggcggcgacggcgacgacgacgataacgacgacgacgacgacg
acgacgacaacgacgatgacgacgacgacgacggcagcaacggcagcaacggcagcggcg
gccggtaacttgtacatcgaggaggggggcacaatgacaccgaggagtaaacgatcgcag
atcgcgcggattcagcgcaacatcgagaccattctcagtcacaagacgagtgaggttgat
cgggattga

DBGET integrated database retrieval system