KEGG   Vollenhovia emeryi: 105558562Help
Entry
105558562         CDS       T06016                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
vem  Vollenhovia emeryi
Pathway
vem00562  Inositol phosphate metabolism
vem01100  Metabolic pathways
vem04068  FoxO signaling pathway
vem04070  Phosphatidylinositol signaling system
vem04140  Autophagy - animal
vem04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:vem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105558562
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105558562
   04070 Phosphatidylinositol signaling system
    105558562
   04150 mTOR signaling pathway
    105558562
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105558562
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vem01009]
    105558562
Enzymes [BR:vem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105558562
    3.1.3.48  protein-tyrosine-phosphatase
     105558562
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     105558562
Protein phosphatases and associated proteins [BR:vem01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    105558562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase DSPn
Motif
Other DBs
NCBI-GeneID: 105558562
NCBI-ProteinID: XP_011861697
LinkDB All DBs
Position
Unknown
AA seq 604 aa AA seqDB search
MFWELMGICFSCRRPTSGRLNSKISEHISASVTPLHVCLEEQRRPELGSCDASQAHKPQV
KRTFESQKAEEEIPEEVAEGDPIQVETGELRQSQPSMANTISNMKMTNPIKGLVSKRRKR
FTEDGFNLDLTYIKANLIAMGFPAEKLEGVYRNHIDDVVKLLESKHKDHYKIYNLCSERS
YDCKKFKQRVATYAFDDHNPPKLEQIKPFCEDVQSWLSQDKDNVAAVHCKAGKGRTGVMV
CCYLLHSKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLLQEGVRYEPVTLLL
RKIQLDPTPIFNGGQGYLHFVISESNKRIFSHDCEVPKGTSSICIPLQSNPPVALTGDIR
VEFYNYRPKMKRKEKMFHFWFNTFFVREKTNSECDNYGELHVERSARAFSCDGTAMELPM
VMSHMKPRTGSLASLGPMPPTLVLRIDKSGLDNAHKDKNHKLYSPDFKVSLFMHSVGGNI
SPAVPAAANRGGDGVQLGMGGQETPSESSEADSSECDTTGDEDGWESGESSASLVVNHQH
HHPLTHSSSRTHVSSLRPRCSLKETAKGLLSRGDKNRNSNRQSVPGASAKRSSAPFARSA
TLDT
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgttctgggaattgatgggtatatgcttttcctgcaggagacccaccagcggcaggttg
aacagtaaaatctctgagcatatctcggcctccgtaacccctctccatgtttgtctggag
gaacaaagaagaccagaactgggctcatgtgacgcctcgcaagctcacaagcctcaggtt
aaaaggacctttgagagtcaaaaggcagaagaagagattcccgaggaggtggctgaaggt
gatccgatccaagtcgagacaggagagttaagacaaagccagccaagcatggccaatact
atcagcaacatgaagatgactaatcccataaaggggcttgttagtaaacgccgcaaacgt
ttcacagaggacggttttaatcttgatctcacatatattaaagcgaatttaatagcgatg
ggtttccctgctgagaagctggaaggagtgtatagaaatcatattgatgacgttgttaag
ctgctggaatctaaacataaagaccattataagatttataacttgtgttccgagaggtcg
tacgattgcaagaagttcaagcagagagtggctacctacgcgttcgatgatcacaatcca
ccaaagctggaacagatcaagcctttctgcgaggacgtgcagtcgtggctgtcccaggac
aaggacaacgtagccgcggttcattgcaaggcgggcaaaggtcgaacgggtgtgatggtg
tgctgttatctacttcacagcaaacagtttcccactgccacggaagcccttaattattac
ggaaccaaacggacccacgataggaaaggcgtaacgataccgtcgcagagaagatacgta
gattattatgctacccttcttcaagagggtgtcaggtatgaaccagtgacgttattactg
cgtaaaatacaactggacccaaccccaattttcaacggaggccaaggctatctgcatttt
gtaatctcggaatcaaacaaaaggatattttcgcacgattgcgaggttccgaaaggtaca
tcttctatctgcatcccattgcaaagcaatcctcccgtcgctctgacgggagatatacgg
gtggagttttacaactacaggccgaaaatgaaacgaaaggagaagatgtttcatttttgg
ttcaacacatttttcgtccgtgagaaaacgaattccgagtgcgacaattatggagagtta
cacgttgaaagatcggcgagggcatttagctgcgacggcacggccatggaattaccgatg
gttatgtcgcacatgaaacctagaactggatcattggcgagtcttggtcccatgccgccc
actctcgttttacggatagacaagtcagggttggacaatgcacacaaggataaaaatcac
aagctctacagtccggattttaaagtgagtctatttatgcatagcgtgggcggcaacata
tcgccagctgtgccagcggcggcgaacagaggtggcgacggtgtgcagctggggatgggc
gggcaggagacgccgagcgagtcgagcgaagcggacagtagcgagtgcgacaccaccggc
gacgaggacggttgggaatccggtgagtcttctgcatccctggtggtgaaccaccaacac
caccaccctcttacacacagcagtagccgtacacacgttagcagtctccgtccgcgatgc
agtctcaaggagaccgccaagggtctgctgtcgcgcggcgacaagaaccggaacagtaac
aggcagagcgtccccggtgcaagcgcgaaacggtcttccgcgccgttcgcgcgctccgcc
actctcgacacgtag

DBGET integrated database retrieval system