KEGG   Vollenhovia emeryi: 105562182
Entry
105562182         CDS       T06016                                 

Definition
(RefSeq) uncharacterized protein LOC105562182 isoform X1
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
vem  Vollenhovia emeryi
Pathway
vem04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:vem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105562182
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 105562182
NCBI-ProteinID: XP_011868194
LinkDB
Position
Unknown
AA seq 128 aa
MRRHLAMEGETDNLYNARLQKVRRRLFHDEDDNDGNAQQEREDVDNRFKEEMRIQQEQKM
KKWNFDFVHGRPLPGRYEWVRLDEHGNEISESNETNGRINSHENGTEEAKDSRQIDGSND
QSGKRNIL
NT seq 387 nt   +upstreamnt  +downstreamnt
atgagacgccacttagcgatggaaggagagactgataacctatacaacgcccgacttcag
aaggtgcgaaggagactttttcacgacgaagatgacaacgacgggaacgcgcaacaggaa
cgcgaggacgttgacaatcgttttaaggaggagatgcgaatacaacaggaacagaaaatg
aagaagtggaactttgatttcgtgcacggaaggccactgcctggccgttacgaatgggtc
agactcgacgagcacggaaatgaaatttccgaatccaacgagacaaacgggagaataaat
tcccatgaaaatggcacggaggaggcgaaagacagcaggcagatcgatgggtcaaacgat
caaagcggcaagagaaacatattgtga

DBGET integrated database retrieval system