KEGG   Vollenhovia emeryi: 105565370Help
Entry
105565370         CDS       T06016                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
vem  Vollenhovia emeryi
Pathway
vem00040  Pentose and glucuronate interconversions
vem00051  Fructose and mannose metabolism
vem01100  Metabolic pathways
Module
vem_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:vem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    105565370
   00051 Fructose and mannose metabolism
    105565370
Enzymes [BR:vem01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     105565370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_16 Methyltransf_25 2-Hacid_dh_C Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 105565370
NCBI-ProteinID: XP_011873891
LinkDB All DBs
Position
Unknown
AA seq 350 aa AA seqDB search
MANDNLTAVLYGINDLRLENTTIEEPGDDEVLLEMGCVGICGSDVHYLVDGRIGDFVVKK
PMIIGHESSGTVAKLGKNVKTLKVGDRVAIEPGVPCRMCTYCKQGHYNLCKDIVFCATPP
VHGSLRRFYKHAADFCFKLPDHVSLEEGALLEPLSVGVHACKRGGIGIDSEVLILGAGPI
GLVTLLVAKAMGASKVVITDIVESRLNVAKKLGADSTYLVQKNRSEEDMVADIHAIFEGE
PNRTIDASGAQASIRLAILATKSGGVVVLVGMGAPEVQVPLISALIREVDIRGVFRYAND
YSDALRLVASGKVDVKPLITHNYKIEETKQAFETSRTGAGGAIKVMIHCK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgacaatctcaccgctgtactgtacggcatcaacgatctgcgcctggaaaat
acgactatcgaggaaccaggggacgacgaagtgctcttggaaatgggatgcgtaggaatc
tgtggatcggatgttcattatcttgttgacggcagaatcggcgattttgtagtgaagaaa
ccaatgatcatcggccatgagtcttccggaaccgttgccaagcttgggaaaaatgtcaag
actttaaaggtcggcgatcgtgttgccattgagcctggtgtgccttgcaggatgtgcacg
tactgcaaacagggacattacaatctgtgcaaggatatcgtgttttgcgcgactccaccc
gtgcacggcagcttaaggcgtttctacaaacatgcagccgatttctgcttcaaattgccc
gatcacgtgagtttagaggaaggagcgcttttagagccattgtcagtgggagtacacgct
tgcaaacggggcggaatcgggatcgattctgaagtattaattctaggtgctggcccgatc
ggtttggtgacgttgctggtagccaaagccatgggcgcgagcaaagtggttatcacggat
atcgtggaaagtagactgaacgtggcgaagaaactaggcgccgacagcacgtatctggtg
caaaaaaatagatcggaggaggatatggtagctgacatacatgcgatcttcgagggtgag
cctaacaggacgatagacgcctccggtgcacaagcctcaattcgtttagcgattctcgcg
actaaatccggtggagtcgtggtattagtgggaatgggtgctccagaggttcaagttcca
ctaataagcgccctgataagagaagtcgacatcaggggtgtcttccgatacgcgaatgac
tacagtgacgcattgaggctcgtcgcgtccggtaaggtagacgtgaagccgttgatcact
cataattacaagatagaggagaccaagcaggcgtttgagaccagcagaactggagcaggc
ggagctatcaaagttatgatccactgtaaatag

DBGET integrated database retrieval system