KEGG   Vollenhovia emeryi: 105567376
Entry
105567376         CDS       T06016                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
vem  Vollenhovia emeryi
Pathway
vem00230  Purine metabolism
vem01100  Metabolic pathways
vem04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:vem00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105567376
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105567376
Enzymes [BR:vem01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     105567376
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF2258
Other DBs
NCBI-GeneID: 105567376
NCBI-ProteinID: XP_011877603
LinkDB
Position
Unknown
AA seq 1006 aa
MSQRQQTPTNEDSYLSCGRPSNLLKTSFSSARLEKLYRASSLQQRRGGLTCFLMSAILYG
LYTLSTPGMELPARCVSAVFLGLNSVLLVQTSCIKPSTARTSVWSVVPCVVGQLWIVHLP
AQLFLKSAKVTPRDSLAWMLLLLYLLFATLPLKLCRCTFLALGSVLVYFIAVIGLSSATL
EELKTQPVDILILTLTLFAGASILGACGYCLAEFQQRRAFLETRQSLEVQLMIEEQSAEQ
ERLLLSVLPEHVAVKMRQDLGASLDTQFKKIYMSRHENVSILYADIVGFTAISSTYSAGE
LVKILNELFARFDQLSERYEQMRIKILGDCYYCISGAPVERPDHAVLCVYMGLSMVEAIK
YVQQTTNSPVDMRVGIHTGAVLAGVLGQRQWQFDVYSKDVELANKMESSGRAGRVHISNA
TLSFLNGEFEVEPAHGEDREEALQKAGLVTYFIVRALKPFKPAVTKSLASLADAENSQRI
IESVQDKVDNIREDSEEFQQRLRKKLDSRGGGTDLKGHASWLTLRFKDPSVETAFHSVEE
AFSPLSLLGGPLVTMCAAPVWRLQPWGPFTWGGAGVVTLFGVVLAGATCLGSAVRATWFR
STLALLMTFSLIIFLLLDMTNCAIIDDVEPAKNTSLNWSPRCPYPSYYSYIGVLALVAIS
MPTYLCYLTKACLMYFLAGAQSCINVLFLASSLDREDVASNQGSVPIPLKYSLAATLFTI
ATALVIVARYAEKARRMLYLRGREVIAQRERAADMKRRNGALIYNILPPHVAAYFLSRAR
HHDDLYSQSYAEVGVLFASMPNFADFYSEESINNQGLECLRFLNEVISDFDAILDQKKFK
SIIKIKTIGSTYMAASGISEVQSVQSEDGPRWGHLVTLVEFALELKKALSSINEQSFNHF
VLKMGINHGPVTAGVIGARKPHYDIWGNTVNVASRMESTGKVGCIQVTDETRKILEPFGF
GFEQRGLVFVKGKGQLLTHYLVSQDGVFLDLDSDLPVEPTHPIIYQ
NT seq 3021 nt   +upstreamnt  +downstreamnt
atgtcgcaacgacagcagaccccgacgaacgaggattcctacctgagctgtggcaggcca
tcgaacctgctgaagacgagcttcagcagcgctcgcctcgagaagctctatcgcgcctcg
tcgttgcagcagcgtcgcggcggcctcacgtgcttcctgatgtcggcgatcctgtacggc
ctctacacgttgtcgacgccggggatggagctgccggcacgttgcgtcagcgccgtattt
ctcggcctgaactccgttttgttagtccagaccagctgcatcaagcccagcacagcgcgc
acctcggtctggtcggtggtgccgtgcgtagtcggacagctgtggatcgtgcacctgccc
gctcagctgttcctcaagtccgccaaggtcacgccgagggacagcctagcatggatgctg
ctgctgctctacttgctgttcgccaccctaccgctcaagctatgccgctgcacgttcctc
gcactcggcagcgtgctcgtgtacttcatcgccgtgattggtctctccagcgcgacgttg
gaggagcttaaaacgcagcctgtcgatattctgatcctgacgctgacgctcttcgccggc
gcctccatcttgggcgcttgtggctactgcctggcggagtttcaacagcgccgcgcgttt
ctggagaccaggcagagcctggaggtccagctgatgatcgaggagcagagcgcggagcag
gagcggttgttgctcagcgtcctgccggagcacgtcgcggtcaagatgcggcaggacctc
ggcgcgtccctcgacacgcagttcaagaagatctacatgtccaggcacgagaacgtgtcg
atactttacgccgacatagtcggcttcaccgcgatctcgtcgacctacagcgccggcgag
ctggtcaagatactcaacgagctcttcgcgcgattcgatcagctcagcgaacgatacgag
caaatgcgcatcaagatcttgggggactgttattactgcataagtggtgcacccgtcgaa
aggccggaccacgcggtcctctgcgtgtacatgggactgtccatggtggaggcgattaaa
tatgttcaacaaacgacgaacagccccgtcgacatgagggtaggcattcacacgggcgcg
gtgctcgccggggtcctcggacagaggcagtggcagttcgatgtctacagcaaggacgtc
gagctggcgaacaagatggagagcagcggaagggcggggagggtacacatctcgaatgca
acgctgagcttcctaaatggggaattcgaggtcgagccggcgcacggggaggatcgggag
gaggcactccaaaaagctggcctcgtcacttactttatcgtgagagccttgaagccgttt
aagccagcggtgacgaaaagcctcgcgtcgctggcggacgcggaaaactcgcaaagaata
atagagagtgtgcaagacaaggtggacaatattcgagaagattccgaggaattccagcaa
cggctgagaaagaaacttgacagtagaggtggtggtaccgacctgaaaggtcatgcctcc
tggttgaccctacggttcaaggatccgagcgtggagacggcgttccatagcgttgaagag
gccttctcgcccctgtcgctcctcggcggacccttggtcacgatgtgcgcagcaccggtc
tggaggctgcagccctggggaccgttcacgtggggtggcgccggggtggtcactctcttc
ggcgtcgtgctggctggagctacctgcctgggcagcgcggtcagggcgacgtggttcaga
agcaccctcgcgctcctcatgacgttctccctcataatcttcctgctattagacatgact
aactgcgcgatcatcgacgacgtcgagccggcgaagaacacctcgctaaactggtccccg
cgatgtccgtacccttcttattattcatacatcggcgtcctggcgctggtcgctatctcg
atgccgacatatctctgttacttgaccaaggcgtgcctgatgtacttccttgccggcgcg
cagtcctgcattaacgtcctgttcctcgcgtcgagcctcgatagggaggacgtggcgtcg
aaccagggatccgttcccatcccgctgaaatattcgctggcggccaccttgttcaccatc
gcgaccgcactagtcatcgtagcgagatacgcggagaaggcgcgaaggatgctgtatctg
cgaggacgagaggtgatcgcgcagagggaacgggcggcggatatgaagcgaagaaacggt
gctctaatatacaacatcctgccgccccacgtagccgcttatttcctgtcgcgcgcgagg
caccacgacgatctctacagccagagctacgccgaggtgggcgtgctgtttgccagtatg
ccaaacttcgcggacttctacagcgaggagagcatcaacaatcaaggcctcgagtgcctc
aggttcctgaacgaagttatctccgacttcgacgccatcctcgatcagaagaaattcaaa
agcatcatcaagatcaagacgataggatcgacctatatggccgcgtcgggaatatccgag
gtgcaatcggtgcagtcggaggacggtccccggtggggccacctcgtcactctcgtcgag
ttcgctctggagcttaaaaaagccctgtcaagcatcaacgagcagagctttaatcacttc
gttttgaaaatgggcatcaatcacggaccggtgactgccggtgtcatcggggcacggaag
cctcactacgacatttggggcaacaccgtcaatgtcgcgtcgaggatggagagcacgggg
aaagtcggctgcattcaggtcaccgacgagacgcggaagatactagagccgttcggtttc
ggcttcgaacaacggggtctcgtcttcgtcaagggcaagggtcagctcttgacgcactac
cttgtctcccaggacggcgtctttctcgacctggacagcgatctgcccgttgaacctacc
cacccgataatctatcagtaa

DBGET integrated database retrieval system