KEGG   Vibrio antiquarius: VEA_000054Help
Entry
VEA_000054        CDS       T01107                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
vex  Vibrio antiquarius
Pathway
vex00473  D-Alanine metabolism
vex01100  Metabolic pathways
vex01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vex00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VEA_000054
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    VEA_000054
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vex01011]
    VEA_000054
Enzymes [BR:vex01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     VEA_000054
Peptidoglycan biosynthesis and degradation proteins [BR:vex01011]
 Precursor biosynthesis
  Racemase
   VEA_000054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACY52742
LinkDB All DBs
Position
2:complement(60029..61258)
Genome map
AA seq 409 aa AA seqDB search
MRLNKTLLSLTIAAATVAPAMQATAAPLQISNTVVKAEQVQGANAWLEINLGQFRDNIEQ
FKSHMDGKTKICAVMKADAYGNGIAGLMPTIIEQQIPCVAVASNAEAQTVRDSGFKGQLM
RVRSADIGEIEAAIDLNIEELIGTAEQAKALSKLAEKADKEIKVHLALNDGGMGRNGVDM
TTKAGKKEALEIAQQDGVNIVGIMTHFPNYNADEVRQKLSSFKDSSAWLIKEAGLKREDI
LLHVANSYTALNVSEAQLDMVRPGGVLYGDLPTNPEYPSIVSFKTRVASVHHLPKNSTVG
YDSSYKTSKESLMANIPVGYSDGYPRKMGNTAEVLINGQRAKVAGVASMNTTMVDITGIK
DVEPGSEVVLFGSQQGKTISAAEMEKHAEVIFPELYTVWGAANPRVYVK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttaaataaaaccttactatcactgactatcgctgctgcaaccgttgctcctgcg
atgcaagctactgctgcccctcttcaaattagcaacactgtagtaaaagcagagcaagtt
caaggcgctaacgcttggctggaaataaacttaggtcaattccgcgataatattgagcag
ttcaagtcgcacatggatggcaaaacgaaaatctgcgccgtgatgaaagccgacgcatac
ggtaatggcatcgcgggcctgatgccgactattatcgaacaacaaatcccttgcgttgcc
gttgcaagtaacgccgaagcacagaccgttcgcgacagtggctttaaaggtcaacttatg
cgtgtacgctcggcggatattggcgagatcgaagccgcaatcgacctaaatatcgaagag
ctgattggtactgcagagcaagccaaagcactgtctaagctagcagagaaagcggataaa
gaaatcaaagttcaccttgctcttaacgacggtggtatgggacgaaatggcgttgatatg
acaacaaaagcgggcaagaaagaagcgctagaaatcgctcaacaagatggcgttaatatt
gttggcatcatgactcatttccctaactacaatgcagacgaagttcgtcaaaagttatct
tcgttcaaagacagctctgcatggctgattaaagaagcgggcctaaaacgcgaagatatt
ttgctgcacgtggccaactcttacactgcacttaatgtttctgaagcacagcttgatatg
gttcgtcctggtggcgttttatacggtgatctgccaaccaaccctgagtacccttctatc
gtgtctttcaaaacacgcgtggcatccgttcaccatctgccaaaaaatagcactgtcggt
tacgacagcagctacaaaacgagcaaagaaagcctaatggcgaacattcctgttggttac
tctgatggctacccacgaaaaatgggcaatacggcagaagtactgatcaatggccaacga
gcaaaagtggcgggtgttgcttcaatgaacaccactatggttgatattacaggtatcaaa
gatgttgagcctggttctgaagttgtactgtttggctctcagcaaggcaaaacgatttcg
gcagcagaaatggaaaaacatgcagaggtcatcttcccagaactatacacggtttggggt
gctgcgaaccctcgtgtctacgtaaaataa

DBGET integrated database retrieval system