KEGG   Vibrio antiquarius: VEA_000154Help
Entry
VEA_000154        CDS       T01107                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vex  Vibrio antiquarius
Pathway
vex00473  D-Alanine metabolism
vex00550  Peptidoglycan biosynthesis
vex01100  Metabolic pathways
vex01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vex00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VEA_000154
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VEA_000154
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    VEA_000154
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vex01011]
    VEA_000154
Enzymes [BR:vex01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VEA_000154
Peptidoglycan biosynthesis and degradation proteins [BR:vex01011]
 Precursor biosynthesis
  Amino acid ligase
   VEA_000154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST TTL
Motif
Other DBs
NCBI-ProteinID: ACY52842
LinkDB All DBs
Position
2:complement(163425..164414)
Genome map
AA seq 329 aa AA seqDB search
MIKNILLLCGGGSSEHEISLLSANFVEQQLNLIEDVHVTRVEIKNEGWMTNQGELVYLDL
NTKQLCSSESNQTIDFIVPCIHGFPGETGDIQSLFEIAGIPYLGCGPEASSNSFNKITSK
LWYDAIGIPNTPYLFLTRNDEEAHTQAHKAFEKWGKVFVKAARQGSSVGCYSVTEKDKLS
NAVNDAFGFSDQVLVEKSVKPRELEVAAYEMNGQLHITKPGEVIAPDGAFYSYDEKYSSS
SHSLTEVEAKNLTQAQLDAIQHASERVFKQMNLRHLSRIDFFLTEDDEIYLNEVNTFPGM
TPISMFPKMLQNNGHKFHEFLEDCINSAK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaatattcttctactatgcggcggcggctcttctgagcacgagatttcatta
ttgtctgcaaactttgtcgaacaacaattaaatcttattgaagacgttcacgttacacgc
gtagaaataaaaaacgaaggttggatgaccaaccaaggtgagttggtttacttggatctc
aataccaagcagttgtgctcaagtgaatctaatcaaaccatcgatttcattgtgccttgt
atacatggttttccaggcgagacaggcgacattcaatctctgtttgaaatcgcaggtatt
ccttatcttggctgcgggccagaagcgagtagcaatagtttcaataaaatcacatctaag
ctttggtacgacgctatcggtattcccaatacgccatacttattcttaacgcgcaacgat
gaagaagctcatactcaagctcataaagcatttgaaaagtggggaaaagtctttgtcaaa
gccgctcgtcaagggtcatctgttggatgttacagcgtcacagaaaaagataaactttcc
aatgcagtaaatgatgcgtttgggttttctgaccaagtgttggttgaaaaatcagtaaaa
ccacgagagcttgaagttgctgcatatgagatgaatggccagctgcacataacgaagcca
ggcgaggttattgcacctgacggtgctttttactcgtacgatgaaaagtacagcagttca
agtcactcgctcaccgaagttgaagcgaagaatctaacccaagcacaattagatgcaatt
cagcacgcatctgagagggtatttaagcaaatgaatcttcgccatttgtctcgtatcgac
tttttcttaacggaagatgatgagatttacttaaacgaagtaaacacattcccaggtatg
actccgatctcgatgttccctaaaatgcttcaaaataacgggcacaaattccatgagttc
ttggaagattgtataaacagtgcaaagtga

DBGET integrated database retrieval system