KEGG   Vibrio antiquarius: VEA_000403Help
Entry
VEA_000403        CDS       T01107                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
vex  Vibrio antiquarius
Pathway
vex00061  Fatty acid biosynthesis
vex00071  Fatty acid degradation
vex01100  Metabolic pathways
vex01212  Fatty acid metabolism
vex02024  Quorum sensing
Module
vex_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:vex00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    VEA_000403
   00071 Fatty acid degradation
    VEA_000403
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VEA_000403
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vex01004]
    VEA_000403
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vex04147]
    VEA_000403
Enzymes [BR:vex01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     VEA_000403
Lipid biosynthesis proteins [BR:vex01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   VEA_000403
Exosome [BR:vex04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   VEA_000403
  Exosomal proteins of breast cancer cells
   VEA_000403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: ACY53091
LinkDB All DBs
Position
2:complement(457279..459231)
Genome map
AA seq 650 aa AA seqDB search
MAQQHNDWADITRLDTFPKVLQHNAKHWPEQVAMREKEFGIWREFTWQDYENRVKWMALA
LQDLGVGEQDVVGLLGDNRPEWVWGELAAHAIKGFSLGIYQDSMHEEVAYLINYAKAKVV
VAEDEEQCDKLLELGDEIPSVEFIIYCDPRGMRKYDDPRLIDVEQVYKKGQLIDKADPDK
YLNMVEATKGSDLSILCTTSGTTSKPKLAQLHSGTFLDHCAAYLRADPRSPGDNYVSVLP
LPWIMEQVYVVGQALISRQIVNFVEEQETMMSDLREIGPNFVLLAPRVWENIVADVSARM
MDSTPFKQKMYKLGMSLANKALEQGKRSKLAEWILLRALRDRLGFSNLTSAATGGAAMGP
DTFRYLQAIGVPLKQLYGQTEMCGAYTVHQADDVDYDSVGVAFDNAEVKVINPDSNGVGE
IIAKSTGMFTGYLNNQEAYDEDVQDGWMHTGDAGYFKDSGHLVVIDRLKDMSETSHGDRY
SPQFIENKLKFSPFIAEAVVVGKGRPWLSAIICIRYAIVAKWAEQRGLAFTNYTNLSAQP
EVYQAIREEVLKVNESLPDAQKISKFILLYKELDADDGELTRTRKVRRGVVAEKYGDIIE
TIYSDDPKVDVDTVITYQDGTKTRIQTSLVIETLIEHEPTLVDSEQRRIA
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcaacataatgattgggcagatataacccgcttagatacctttccaaaagtg
ttgcagcacaatgccaagcactggcccgagcaagtcgcaatgcgtgaaaaggagtttggc
atttggcgagagttcacttggcaagattatgaaaatcgagtgaagtggatggctctggca
ctgcaagatttaggtgttggtgagcaagacgttgttggtttgctgggtgataaccgcccg
gaatgggtatggggcgagttggccgcacatgcgatcaaaggtttctcgctgggcatctat
caagattccatgcacgaagaagtggcgtacctcatcaactatgccaaagcaaaagtcgtg
gttgccgaagatgaagagcaatgcgataagctacttgagctcggtgatgagatcccaagc
gtagaattcattatctattgtgacccgcgtggaatgcgcaagtacgacgatccacgactg
attgatgttgagcaggtctataaaaaaggtcaactgatcgacaaagcggatccggataaa
tatctcaatatggttgaggcaaccaaaggcagcgatctttcgattctttgtaccacgtcg
ggtacgacttccaaaccaaagttggctcagctacacagcggcactttcttagatcactgt
gcggcttatctgcgtgccgacccgcgctctccaggcgacaactacgtttctgttctgcct
ttgccttggattatggagcaggtgtatgtggttggtcaggcgttgatttctcgtcaaatc
gttaacttcgtggaagaacaagaaaccatgatgtctgacttgcgcgaaattggcccgaac
ttcgtcctacttgcaccgcgtgtatgggaaaacattgtggcagacgtgtctgcacgaatg
atggattccacaccgtttaagcagaagatgtacaaactgggcatgagcttagccaacaaa
gcgctggagcagggtaaacgctctaagttggctgaatggattcttctgcgtgctctgcgt
gaccgtttagggttttcgaacctgacatctgcggcaaccggcggtgcggcgatgggaccg
gatactttccgttacttgcaagcgatcggtgtaccactcaagcagctttacggtcaaacc
gaaatgtgtggtgcgtacaccgtccaccaagccgatgacgtggactatgattcggtcggc
gttgcgtttgataatgcagaagtgaaagtcatcaacccagacagcaatggcgtgggtgag
atcatcgcgaaaagtaccggcatgtttactggctacctgaacaaccaggaagcgtatgac
gaagacgtacaagacggatggatgcatacgggtgatgcgggttactttaaagattctggt
cacttggtggtgattgatcgtctgaaagacatgtcggaaaccagccatggcgaccgctac
tctccgcagttcattgaaaacaaactcaagttttcgccgtttattgcagaagccgtagtg
gtgggcaaaggtcgaccttggctatccgccatcatctgtattcgctacgcgattgttgcg
aagtgggcagagcagcgaggcttagcattcactaactacaccaacttatctgctcaacca
gaagtgtatcaagctattcgtgaagaagtgctgaaagtgaacgaatccctacccgatgca
cagaagatcagcaaattcattctactttacaaagagctagatgccgacgatggcgagcta
actcgcacacgtaaagtacgccgtggtgtggttgcagagaaatacggagacatcatcgaa
accatctacagtgacgatccaaaagtcgatgtggatacggtgatcacttatcaggatggc
accaaaacacgcattcaaacgtcgctagtgattgaaacgcttattgaacatgagccaaca
ctagtggatagcgaacaacggaggatcgcatag

DBGET integrated database retrieval system