KEGG   Vibrio antiquarius: VEA_000595Help
Entry
VEA_000595        CDS       T01107                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
vex  Vibrio antiquarius
Pathway
vex00550  Peptidoglycan biosynthesis
vex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vex00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VEA_000595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:vex01002]
    VEA_000595
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vex01011]
    VEA_000595
Enzymes [BR:vex01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VEA_000595
Peptidases [BR:vex01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   VEA_000595
Peptidoglycan biosynthesis and degradation proteins [BR:vex01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   VEA_000595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ACY53281
LinkDB All DBs
Position
2:complement(690100..691269)
Genome map
AA seq 389 aa AA seqDB search
MRKSTILNTVLITGFAAVSSLAYAAPTVVPNAPELSSRGYVLMDFHTGKVLVERDAHKRL
NPASLTKLMTAYVAGQEINAGNITLDDEVVISRNAWAKNFPDSSKMFIEVNTSVSLSDLY
RGLVVQSGNDASVAIAEHVAGSESGFVSLMNSWAAKLELNNTAFTNPHGLDSDGLYSTPY
DIAKLGQAIIRDLPDIYPLYSETSFTYNGITQYNRNGLLRDRSMNVDGMKTGYTSGAGYS
LATSATQGDMRLIAVVMGAKSENIRESESKQLLSYGFRFYDTVMPTEAGTEVANARVWMG
EQDELKVGVANDVYLTLPKGDVKKLQAEVEYNGDLVAPISQQQVVGKVLYKVEGKVVNEA
ELVALESVEEGSLFKRILDWFKQLVASWL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaagtactatattaaacacagtgttaattacagggttcgctgctgtatcttcg
ttggcttatgcagcaccaacggttgtgccaaatgcaccggaactcagttctcgtggctat
gttttgatggactttcacactgggaaagtgctggttgaacgtgatgcacataaacggcta
aatcctgcgagcttaacgaagttaatgacggcttatgtggctggtcaagaaattaacgca
ggtaatattactttggatgatgaggtcgtcattagccgaaatgcttgggcaaaaaacttc
ccagattcctcaaagatgtttattgaagtcaatacttccgtttctttatctgacttatac
cgtggcctggttgttcaatcaggtaatgatgctagtgtggccattgctgaacatgtcgca
ggtagtgaatcagggtttgtaagcttgatgaatagttgggctgctaagcttgaattaaat
aacacggctttcaccaaccctcatggtctagacagtgacggtttatattcaacaccttat
gacattgccaagttgggtcaagctattattcgtgacttacctgacatctacccactgtat
agcgaaacttcgtttacctacaacggcattacgcaatataaccgcaatggcttgcttcgt
gatcgcagtatgaatgttgatggcatgaaaactggttatacgagcggtgctggttatagt
ctagcgacttcagcgactcaaggtgatatgcgtttaattgcagttgtgatgggagcaaaa
agtgagaatatccgtgaatccgaaagcaaacaactgctaagttatggcttccgcttttac
gatacggtaatgccaaccgaggcaggaacggaagttgcgaacgctcgagtttggatgggc
gaacaagatgaactgaaagtaggcgtggccaatgacgtttatcttactttaccaaaaggg
gatgtgaaaaagctacaagctgaggttgaatataatggcgatttggtagcgccaatttct
caacaacaagtggttggtaaagtgctttacaaagtcgaaggtaaagttgtgaatgaagcc
gaacttgttgcgttggaatcagtggaagaaggcagcttattcaagcgaattttagactgg
tttaagcaattggtcgcgagttggctataa

DBGET integrated database retrieval system