KEGG   Vibrio antiquarius: VEA_002303Help
Entry
VEA_002303        CDS       T01107                                 

Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
vex  Vibrio antiquarius
Pathway
vex00620  Pyruvate metabolism
vex01100  Metabolic pathways
vex01120  Microbial metabolism in diverse environments
vex01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VEA_002303
Enzymes [BR:vex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     VEA_002303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: ACY50465
LinkDB All DBs
Position
1:754692..755969
Genome map
AA seq 425 aa AA seqDB search
MSEDNRQAATPEEEHRQKALDYHAYPTPGKIAVELTKPAETAGDLALAYSPGVAEPVREI
AQNPDNVYKYTAKGNMVAVISNGTAILGLGNLGPLASKPVMEGKALLFKRFAGLDSIDIE
VKHRTIDEFVDTVASIADTFGGINLEDIKAPDCFEIEKRLIERCDVPVFHDDQHGTAIVT
AAGMLNAIELQGKKLEDSTIVCLGAGAAAVACMELLIKCGAMREKIYMLDRKGVIHTRRD
DLNEYKQLFANNTDKRTLEDVIEGADLFLGVSGPNLLPAEALKLMADKPIVFACSNPDPE
IKPELAHAVRDDLIMGTGRSDYPNQVNNVLCFPFIFRGALDVRASEINDEMKLAAVEAIR
ELAKEPVPETVLKAAGVDKLEFGADYIIPKPMDSRLLPRVAKAVAQAAVDSGVARIEMPE
NYMAE
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagacaatcgccaagcagccactccagaagaagaacatcgccaaaaagcattg
gattaccatgcttatccaaccccagggaagattgctgtcgaattgacaaagcctgcggaa
acggcgggtgatcttgcccttgcttacagccctggtgttgcagaaccagtgcgtgagatc
gcacaaaaccctgataacgtgtacaagtacacagcgaaaggcaacatggttgctgttatt
tctaacggtaccgctattttaggtctaggtaacctaggtccacttgcatctaagccagta
atggaaggtaaagcgttactgtttaagcgttttgctggccttgactcgattgatattgaa
gttaagcaccgcacgatcgatgaatttgttgatactgtcgcaagcattgcagacaccttt
ggtggtatcaaccttgaagatattaaagcaccagattgctttgagattgaaaagcgttta
attgagcgttgtgatgtaccagtattccacgatgatcagcacggtactgcgattgtaacg
gcggcaggcatgctgaacgcgatcgaacttcaaggtaagaagcttgaagactcaacgatc
gtttgtcttggcgctggcgctgcagctgttgcgtgtatggagctgctgattaaatgtggt
gcaatgcgcgaaaaaatttacatgctggatcgtaaaggtgtgatccacactcgtcgtgat
gatcttaatgaatacaagcagctattcgcaaacaacacggacaaacgcacattagaagat
gtgattgaaggcgcggatctgttcctaggtgtatctggtccaaacctattgccagcggaa
gcgttgaagctgatggcagataagccaatcgtatttgcatgttcgaatccagatcctgaa
attaagcctgaacttgcccacgctgttcgtgatgatttgatcatgggtactggccgtagt
gattacccgaaccaagtaaacaacgtattatgtttcccattcatcttccgtggtgctctt
gatgtgcgcgcaagtgaaatcaatgatgaaatgaaacttgcagccgttgaggcgattcgt
gagctagcaaaagagcctgtacctgaaactgtattgaaggccgcaggcgtcgataagctt
gagtttggtgcagactacatcattccaaaaccaatggactcacgtttactaccacgtgtt
gcaaaagctgtggctcaggcggcagttgattcaggtgttgctcgtatcgagatgcctgaa
aactacatggcagagtaa

DBGET integrated database retrieval system