KEGG   Vibrio antiquarius: VEA_002931
Entry
VEA_002931        CDS       T01107                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
vex  Vibrio antiquarius
Pathway
vex00010  Glycolysis / Gluconeogenesis
vex00071  Fatty acid degradation
vex00350  Tyrosine metabolism
vex00620  Pyruvate metabolism
vex00625  Chloroalkane and chloroalkene degradation
vex00626  Naphthalene degradation
vex00650  Butanoate metabolism
vex01100  Metabolic pathways
vex01110  Biosynthesis of secondary metabolites
vex01120  Microbial metabolism in diverse environments
vex01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VEA_002931
   00620 Pyruvate metabolism
    VEA_002931
   00650 Butanoate metabolism
    VEA_002931
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VEA_002931
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    VEA_002931
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VEA_002931
   00626 Naphthalene degradation
    VEA_002931
Enzymes [BR:vex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VEA_002931
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     VEA_002931
SSDB
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Other DBs
NCBI-ProteinID: ACY51093
LinkDB
Position
1:1471394..1474096
AA seq 900 aa
MPVTNMAELDAMIARVKKAQEEFATYSQEQVDKIFRAASLAANQARIPLAQQAVEESGMG
IVEDKVIKNHFASEFIYNKYKDEQTCGILEEDDNLGTMTIAEPVGIICGIVPTTNPTSTA
IFKSLISLKTRNGIIFSPHPRAKNSTNDAAKLVLDAAVAAGAPKDIIGWIDQPSVELSNA
LMKHDDIALILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDETADIKRAVASILMSKTF
DNGVVCASEQAAIVVDEVYDEVKERFASHKAYVLSKAEAEKVRKVLLIDGALNAKIVGQP
AAAIAEMAGVKVPADTKVLVGEGLGKVSHDDAFAHEKLSPTLGLFRADNFEDAVAQAVTM
VEIGGIGHTSGLYTNQDTNADRIRYFGDKMKTARILINIPTTHGGIGDLYNFNVAPSLTL
GCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALGDLEGKKR
AFLVTDRFLFNNGYADDVVSLLKAQGMEVQTFFDVEADPTLSVVEKGAAQMASYQPDVIL
ALGGGSPMDAAKIMWVMYEHPETHFEELAMRFMDIRKRIYKFPKMGQKAELVCITTTSGT
GSEVTPFAVVTDDKTGAKYPLADYEITPNMAIVDANLVMNMPKSLTAFGGYDAVTHALEA
YVSVLANEYSDGQALQALKMLKEYLPSSYANGANDPIAREKVHNAATIAGVAFANAFLGV
CHSMAHKLGAEFHIPHGLANALLISNVVRYNANDNPTKQTAFSQYDRPQARRRYAEVADH
LGLSQAGDRTAQKIERLLAWLDELKVNLDIPMSIQAAGVAEADFIAKLDELAVEAFDDQC
TGANPRYPLISELKDVLMASYYGKAFVEGETFEGTTVIKKKADQEAAKAAPKAKKEKADA
NT seq 2703 nt   +upstreamnt  +downstreamnt
atgcctgtaactaatatggctgaactagatgcaatgattgctcgcgttaagaaagcgcaa
gaagagttcgctacttactctcaagagcaagtagacaaaatcttccgtgcagcatcgctt
gcagctaaccaagcccgtatcccgctagctcaacaagcggttgaagaatctggtatgggt
attgttgaagataaagtaatcaagaaccacttcgcttctgagtttatctacaacaaatac
aaagacgaacaaacgtgtggcatcctagaagaggatgacaacctaggtactatgactatc
gctgaacctgtaggtatcatctgcggtatcgtaccaacgactaaccctacatctacagcg
atcttcaaatctctaatctctctgaagactcgtaacggtatcatcttctcaccacaccca
cgtgcgaaaaactcgactaacgacgcagcgaaactggttctagacgcagcagtagcagcg
ggtgcaccaaaagacatcatcggttggatcgaccaaccttctgttgagctttctaacgct
cttatgaaacacgatgacatcgcgcttatccttgcaactggtggcccaggcatggttaaa
gcagcttactcttctggtaaaccagcaatcggtgtaggtgcaggtaacgttcctgttgtt
atcgacgaaactgctgacatcaaacgtgcagtggcttctatcctgatgtctaagactttc
gacaacggcgtagtatgtgcttctgagcaggctgcaatcgtcgttgatgaagtgtacgac
gaagtaaaagagcgttttgcttctcacaaagcttacgtactaagcaaagcagaagcagaa
aaagttcgtaaagttcttcttatcgatggcgcgctaaacgcgaaaatcgtaggtcagcca
gcagcggcaatcgctgaaatggcaggcgttaaagttccagcagacacgaaagtccttgtt
ggtgaaggtctaggtaaagtgtctcacgatgacgcattcgctcacgagaaactatctcca
actctaggtctattccgtgctgacaacttcgaagacgcggttgctcaagcggtaactatg
gttgagattggtggtatcggccacacatctggtctttacactaaccaagatactaacgct
gaccgtatccgttacttcggtgacaagatgaagacagctcgtatcctaatcaacatcccg
actactcacggtggtatcggtgacttgtacaacttcaacgttgcgccttctctaactcta
ggttgtggttcatggggtggtaactctatctctgagaacgtaggtcctaaacacctaatc
aacaagaaaactgtagcgaagcgagctgaaaacatgttgtggcataaactacctaagtca
atctacttccgtcgtggtagccttccaattgctctaggcgacctagaaggtaagaagcgc
gcattcttagtaactgaccgtttcctattcaacaatggttacgcagatgacgtagtaagc
ctacttaaagctcaaggcatggaagttcaaacattcttcgatgttgaagctgacccaacg
ctttctgtagtagagaaaggtgcggctcaaatggctagctaccaaccagacgttatccta
gcgctaggtggtggttcaccaatggatgctgcgaagatcatgtgggtaatgtacgagcac
ccagaaactcacttcgaagaactagcaatgcgctttatggacatccgtaaacgtatttac
aagttccctaaaatgggtcaaaaagctgagcttgtatgtatcaccacaacttcaggtact
ggttcagaagttacaccatttgcggttgttactgacgacaagactggtgctaaataccca
ctagctgactacgaaatcacgccaaacatggctatcgttgatgctaacctagtgatgaac
atgcctaagtctctaacagcatttggtggttacgatgcagtaactcacgctctagaagct
tacgtatctgttcttgcgaacgaatactcagatggtcaggctctacaagcacttaagatg
ctaaaagaatacttaccttcaagctacgcgaacggcgctaacgacccaatcgctcgtgag
aaagtacacaacgccgcaactatcgctggtgtggcatttgctaacgcattcctaggtgtt
tgtcactcaatggcgcacaaactaggtgctgagttccacattccacatggcctagcaaac
gcactacttatctctaacgttgtacgttacaacgcgaacgataacccaactaaacaaaca
gcgttctctcaatacgaccgcccacaagcacgtcgtcgttacgctgaagttgctgaccac
ttaggtctaagccaagctggtgaccgtactgctcagaaaattgaacgtctactagcatgg
ttggatgagctaaaagtgaacctagacatcccaatgtctatccaagcggcaggcgtagct
gaagcagactttatcgcgaaacttgatgagctagcagttgaagcgttcgatgaccaatgt
actggtgcgaaccctcgctacccactaattagcgaacttaaagatgtgttaatggcttct
tactacggtaaagcattcgttgaaggtgaaactttcgaaggtacaacagttatcaagaag
aaagcagaccaagaagcagcgaaagcggcgcctaaagcaaagaaagaaaaagctgacgcg
taa

DBGET integrated database retrieval system