KEGG   Vibrio antiquarius: VEA_002943
Entry
VEA_002943        CDS       T01107                                 

Definition
(GenBank) endonuclease III
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
vex  Vibrio antiquarius
Pathway
vex03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:vex00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    VEA_002943
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vex03400]
    VEA_002943
Enzymes [BR:vex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     VEA_002943
DNA repair and recombination proteins [BR:vex03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     VEA_002943
 Prokaryotic type
     VEA_002943
SSDB
Motif
Pfam: HhH-GPD HHH EndIII_4Fe-2S
Other DBs
NCBI-ProteinID: ACY51105
LinkDB
Position
1:complement(1482056..1482697)
AA seq 213 aa
MNKIKRIEILERLRENNPNPQTELNWSSPFELLIAVLLSAQATDVSVNKATDKLFPVANT
PKSILDLGVDGLKEYIKTIGLFNSKAENTIKTCKILLEKHNGEVPEDRAALEALPGVGRK
TANVVLNTAFGWPTIAVDTHIYRVSNRTKFAMGKTVDDVEQKLLKVVPKEFKLDVHHWLI
LHGRYTCLARKPRCGSCIIEDLCEYKEKVYPDS
NT seq 642 nt   +upstreamnt  +downstreamnt
atgaacaaaataaaaagaatcgaaattcttgagcgattacgagaaaacaatccgaatcct
caaactgagcttaactggagctccccttttgagctgctaatcgcggtattactatcagcg
caagcaaccgatgtaagtgtcaataaagccaccgacaagcttttccctgtcgctaataca
ccgaaaagtattctcgatttgggagttgatggcttaaaagaatacataaagaccatcggt
ttatttaactcaaaagcagaaaacactatcaagacttgtaagatcttgttggaaaaacac
aatggtgaagttcctgaagatcgtgcagcgttagaagcgctaccaggcgtaggtcgcaag
accgcaaacgtcgtgctcaacaccgcttttggttggccaaccattgccgtcgatacgcac
atttatcgcgtgtcgaatcgtactaagtttgcaatgggcaaaacggttgatgatgtcgag
caaaagctattaaaagttgtgccaaaagagttcaaactcgatgtgcaccactggctcatt
cttcatggccgctacacgtgcttggcgagaaagcctcgctgcggtagctgcattattgaa
gatttgtgcgaatataaagagaaagtatatccagatagctaa

DBGET integrated database retrieval system