KEGG   Vibrio antiquarius: VEA_003759Help
Entry
VEA_003759        CDS       T01107                                 

Definition
(GenBank) glutamate decarboxylase eukaryotic type
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vex  Vibrio antiquarius
Pathway
vex00250  Alanine, aspartate and glutamate metabolism
vex00410  beta-Alanine metabolism
vex00430  Taurine and hypotaurine metabolism
vex00650  Butanoate metabolism
vex01100  Metabolic pathways
vex01110  Biosynthesis of secondary metabolites
vex01120  Microbial metabolism in diverse environments
vex02024  Quorum sensing
Module
vex_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VEA_003759
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VEA_003759
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VEA_003759
   00430 Taurine and hypotaurine metabolism
    VEA_003759
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VEA_003759
Enzymes [BR:vex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VEA_003759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS HSCB_C FAD-SLDH Aminotran_1_2 DegT_DnrJ_EryC1 AAA_33 DUF5446
Motif
Other DBs
NCBI-ProteinID: ACY51919
LinkDB All DBs
Position
1:2378618..2380264
Genome map
AA seq 548 aa AA seqDB search
MVKEQKTADVSFESLLKIFTVPEGPDSTLTKIDESLSRNLNQFLREHIVAEEKPLREIEK
DFSSAQIPEQPEFVSDHTEHLLDTLVSHSVHTSSPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYGQSDTFYDQWMHSANHSLGAFCSGGTIANITA
LWVARNKALRANGSFKGVEKEGLFKAMKHYGYDGLAVLVSERGHYSLKKAADVLGLGQEG
LVAVKTDANNRIIVDDLKAKIVELEKQNIKPIAVIGVAGTTETGNVDPLPEIAEVCQAHG
CHFHVDAAWGGATLMSNHHRHLLNGVEMADSVTIDAHKQLYIPMGAGMVLFKDPDAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLIDQSIEKARYFADL
IKQQDDFELVSEPELCLLTYRYLPPFIREALAKAEGSQKEQLNELINELTQFIQKRQRET
GKSFVSRTRLNPDQWQRMNTIVFRVVLANPLTTKEILSSVLDEQREIAKQAPNLMERIQQ
VVTDIQSS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggaacaaaaaaccgctgacgttagctttgagagcttgctaaagatcttcact
gtcccagaaggtcctgactcaacgttaaccaaaattgacgagagcctctcgcgaaatcta
aatcaatttcttcgtgaacacatcgtggcagaagaaaagcctttacgcgaaatcgaaaaa
gacttttcttctgctcagattcctgagcagccagagttcgtgtcagatcatacagaacac
ttactcgacactttggtgtcgcactccgttcacacttcttcaccaagcttcattggtcat
atgacatcggcgctgccttatttcttgatgccactgtcaaagatcatgatcgccttaaac
caaaacctggtaaagatagagacttctaaagcctttaccccgcttgaacgtcaagttttg
ggcatgctacatcgcttgatctatggtcagagcgatacgttttacgatcagtggatgcat
agcgcaaaccactcattgggcgcattttgctccggcggtaccattgccaatatcactgca
ctttgggtagcacgtaacaaggcgttaagagccaatggttcatttaaaggcgttgagaaa
gaaggcctatttaaagccatgaagcattatggctacgatggcttagcggtattggtgtct
gagcgtggtcactactcccttaagaaagcagccgatgtactaggtctaggtcaagaaggc
ttggttgcggttaaaacggatgccaacaaccgtattattgtcgacgaccttaaagcgaaa
attgttgaactagagaaacaaaacatcaagcctattgctgttattggtgtagctggtaca
acagagacaggtaatgtcgacccgctacctgaaatcgcagaagtctgccaagctcacggt
tgtcatttccatgtggatgccgcatggggtggcgcaacacttatgtctaatcaccaccgt
caccttcttaacggtgtggaaatggcagactcagtaaccattgatgcgcacaagcaactc
tacatcccgatgggcgctggtatggttctgttcaaagaccctgacgcaatgaaatccata
gagcatcacgctcaatatatcttgcgtaaaggctcaaaagacctaggcagccatacatta
gaaggctctcgttcgggcatggcaatgttagtctatgccgcaatgcacatcatcagccgc
cctggctatgagctgctgatagaccaaagcattgaaaaagctcgctactttgcggattta
atcaagcaacaagatgatttcgaattggtttctgaaccagagctttgtctgctcacatac
cgctacttgccgccattcatccgtgaggcattagcaaaagcggaaggttcacaaaaagaa
caactgaatgaactgattaatgaattaacacagtttattcaaaagcgtcagcgtgaaacg
ggcaaatcgtttgtttcacgtacaagactgaacccagaccaatggcagcgcatgaacacg
attgtgttccgagtggttttggcgaatccgctgacgaccaaagaaattttgagttcggtg
cttgatgaacagcgtgaaatcgccaagcaagcaccaaatttgatggaaagaattcagcag
gtggtcactgatatccaatcgtcttaa

DBGET integrated database retrieval system