KEGG   Vibrio antiquarius: VEA_004113Help
Entry
VEA_004113        CDS       T01107                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
vex  Vibrio antiquarius
Pathway
vex00020  Citrate cycle (TCA cycle)
vex00190  Oxidative phosphorylation
vex00650  Butanoate metabolism
vex01100  Metabolic pathways
vex01110  Biosynthesis of secondary metabolites
vex01120  Microbial metabolism in diverse environments
vex01130  Biosynthesis of antibiotics
vex01200  Carbon metabolism
Module
vex_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vex_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vex_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VEA_004113
   00650 Butanoate metabolism
    VEA_004113
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    VEA_004113
Enzymes [BR:vex01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     VEA_004113
    1.3.5.4  fumarate reductase (quinol)
     VEA_004113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_4 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: ACY52273
LinkDB All DBs
Position
1:complement(2780177..2780887)
Genome map
AA seq 236 aa AA seqDB search
MKLNFSLYRYNPDVDTKPYMKEYTLEVDEGSDMMVLDALILLKEQDPSIAFRRSCREGVC
GSDGLNMNGKNGLACITPLSALQGDKIVIRPLPGLPVVRDLIVDMTQFYDNYAKVKPFLI
DDGALPPSRENLQSPDDRAHLDGLYECIMCACCTTSCPSFWWNPDKFIGPAGLLAAYRWL
IDSRDTATDERLSDLDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLVNRSV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaacttctctttataccgttacaatccggatgtggataccaagccttacatg
aaagagtatacccttgaggtagacgaaggctcagacatgatggtgcttgatgcattgatt
ctgctaaaagagcaagatccaagcatcgcgttccgtcgctcatgccgtgaaggggtatgt
ggttctgatggtttgaacatgaatggtaaaaatggtctagcgtgtatcacaccgttatct
gctctacaaggcgataagatagttattcgtccactgccagggttacctgtcgtgcgcgat
cttatcgttgacatgacacaattctatgataactatgcgaaagttaaaccattcttgatt
gatgatggtgcattaccaccatcacgcgagaacctacaatcacctgatgatcgtgctcat
ttagatggattgtacgaatgtatcatgtgtgcatgttgtacaacgtcttgcccatcattc
tggtggaaccctgacaaattcatcggtccagctggtcttcttgcggcgtaccgttggcta
attgatagtcgcgatacggcaacagatgaacgtttgtctgatcttgatgatgcatttagc
gtttttcgttgccatggcatcatgaattgtgtaagtgtttgtcctaagggattaaatccg
acgaaagccatcggccatattaagtcgatgctggttaatcgctcggtttaa

DBGET integrated database retrieval system