KEGG   Vibrio antiquarius: VEA_004114Help
Entry
VEA_004114        CDS       T01107                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
vex  Vibrio antiquarius
Pathway
vex00020  Citrate cycle (TCA cycle)
vex00190  Oxidative phosphorylation
vex00650  Butanoate metabolism
vex01100  Metabolic pathways
vex01110  Biosynthesis of secondary metabolites
vex01120  Microbial metabolism in diverse environments
vex01130  Biosynthesis of antibiotics
vex01200  Carbon metabolism
Module
vex_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vex_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vex_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VEA_004114
   00650 Butanoate metabolism
    VEA_004114
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    VEA_004114
Enzymes [BR:vex01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     VEA_004114
    1.3.5.4  fumarate reductase (quinol)
     VEA_004114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like Thi4 FAD_binding_3 DAO BEX
Motif
Other DBs
NCBI-ProteinID: ACY52274
LinkDB All DBs
Position
1:complement(2780903..2782669)
Genome map
AA seq 588 aa AA seqDB search
MSIPVREFDAVVIGAGGAGMRAALQISEQGLSCALLSKVFPTRSHTVSAQGGITVALGNS
HKDDWQWHMYDTVKGSDYIGDQNAIEYMCKNGPESVIELEKMGLPFSRFDNGTIYQRPFG
GQSKEFGGEQAARTAAAADRTGHALLHTLYQQNVKHKTTIFSEWYALDLVKNQDGAVMGC
TAICMETGEICYFKSKATILATGGAGRIYASTTNAHINTGDGVGMALRAGVPMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMIEIREG
RGCDGPWGPHIKLKLDHLGKEVLESRLPGICELSRTFAHVDPVKEPIPVIPTCHYMMGGV
PTQVSGQAIKQKADGSEMEVQGLYACGEIASVSVHGANRLGGNSLLDLVVFGRATGLHLG
ETLAAQAEARPATESDIEASLARTMRWENSTGGEDPVQIRKDLQACMQNSFSVFREGDAM
ATGLEELKVIRERLKDAHLADKSSEFNTQRIECLELDNLMETAFSTAVAANYRTESRGAH
ARFDFPERDDENWLCHSIYNPETEAMTKRDVNMTPTHREAFPPKVRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgtctattccagttcgtgagtttgacgccgtagtaatcggcgctggtggtgcaggtatg
cgcgctgcactacaaatttcagaacaaggcctatcatgtgctttgttgtcaaaagtattt
ccaacacgttctcatactgtgtctgcacagggcggtattaccgttgctctgggtaactcg
cacaaagacgattggcaatggcacatgtatgataccgttaaaggttccgattacatcggt
gaccagaacgcgattgaatacatgtgtaaaaatggccctgagtccgttatcgaactagaa
aaaatgggtcttccattctctcgttttgataacggtactatctaccaacgtccattcggt
ggtcagtcaaaagaatttggtggtgagcaagctgcacgtacagcagcagctgcggaccgt
acaggtcacgcgcttctgcatacgctttaccaacaaaatgtgaaacacaaaaccaccatt
ttctcggaatggtatgcactagacttggtgaaaaaccaagacggcgccgtaatgggctgt
actgcgatttgtatggaaacaggcgagatttgttacttcaaatcgaaagcaacgattcta
gcaacaggtggtgcaggtcgtatttacgcgtcgaccactaacgcacacatcaacactggt
gacggtgtaggtatggcattgcgtgcgggtgtacctatgcaagacatggaaatgtggcag
ttccacccaacgggtatcgctggtgcaggtgttcttgtaacagaaggttgtcgtggtgaa
ggtggttaccttctaaataaagatggcgaacgcttcatggagcgctatgctcctaacgcg
aaagaccttgcaggtcgtgacgtagttgcacgttcaatgatgatcgaaattcgtgaaggc
cgtggttgtgatggtccttggggtccacacattaagctgaagttggatcaccttggtaaa
gaagtgcttgagtcacgtctgcctggtatctgtgagctgtctcgtactttcgcgcacgtt
gatccagtgaaagagccaattccagtaattccaacctgtcactacatgatgggtggtgta
ccgactcaagtgtctggccaagcaatcaagcaaaaggctgacggcagcgagatggaagta
caaggtctatatgcatgtggtgagattgcttctgtatcagtacacggagcaaaccgtcta
ggcggcaactcattactagacttggtcgtgtttggtcgcgcgactggcttgcaccttggc
gaaacgctcgcagcgcaagctgaggcacgccctgcaactgaatctgatattgaagcatct
ctagcgcgtaccatgcgttgggaaaatagtactggcggtgaagatccagttcaaatccgt
aaagacctacaagcttgcatgcaaaacagcttctcggtattccgtgaaggcgatgcaatg
gcaacgggtctagaagagttgaaagtgattcgcgaacgtctgaaagatgcacatctagcg
gacaagtcttctgaattcaacacgcaacgtattgagtgtctagagctagacaacttgatg
gaaacagcattctctacagccgtagcggctaactaccgtactgaaagccgtggcgcacat
gctcgtttcgatttccctgagcgtgatgatgagaactggctatgccactctatctacaac
ccggaaacagaagcgatgactaagcgtgatgtgaacatgacgccaacgcatcgtgaagct
ttcccgccgaaagtacgtacatactaa

DBGET integrated database retrieval system