KEGG   Vitreoscilla filiformis: VITFI_CDS0045Help
Entry
VITFI_CDS0045     CDS       T04960                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
vff  Vitreoscilla filiformis
Pathway
vff00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vff00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VITFI_CDS0045
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vff02000]
    VITFI_CDS0045
Enzymes [BR:vff01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     VITFI_CDS0045
Transporters [BR:vff02000]
 Other Transporters
  Pores ion channels [TC:1]
   VITFI_CDS0045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C_3 GST_C GST_C_2 LVIVD
Motif
Other DBs
NCBI-ProteinID: ASM75824
UniProt: A0A221K9Y3
LinkDB All DBs
Position
37327..37935
Genome map
AA seq 202 aa AA seqDB search
MKLFYSPGACSLSPHIALREAGLPFELVLASPKTKQLADGSDYRIINPKGQVPALLLDDG
QLLTEGAVIVQYIADQVAPSELLPAAGTMARYRVLEWLNYITTELHKSFGPLFNPTFPVE
GKPFFQNALLQRLAWVDSQLASQPYLTGEAFTVADGYLFVVTNWTKFVGLDISNLPHLGA
FMGRVAARPAVQAALQAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttttttacagccctggcgcttgctcgctgtccccgcacattgccctgcgtgaa
gcgggtttgccgttcgaactggtgctggccagcccgaaaaccaaacaactggccgacggc
agcgattaccgcatcatcaaccccaaaggccaggtgcccgccctgctgctggacgatggc
caactgctgaccgaaggcgctgtcatcgtgcagtacatcgccgaccaagtcgcccccagc
gagctgctgcccgccgccggcacgatggcgcgctaccgcgtgctcgaatggctgaactac
atcaccaccgaattgcacaagagtttcggcccgctgttcaaccccaccttcccggtcgaa
ggcaaaccgtttttccaaaacgcgctgctgcaacgcttggcctgggtggacagccaactg
gccagccaaccctacctcaccggtgaagcgttcaccgtggcggatggttacttgtttgtg
gtgacgaattggacgaaattcgtcgggctggacatctcgaacttgccgcacttgggcgcg
ttcatgggccgcgtggcggcacgccccgccgtgcaagccgccctccaagcggaaggcctg
ctgaagtaa

DBGET integrated database retrieval system