KEGG   Vitreoscilla filiformis: VITFI_CDS1042Help
Entry
VITFI_CDS1042     CDS       T04960                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
vff  Vitreoscilla filiformis
Pathway
vff00630  Glyoxylate and dicarboxylate metabolism
vff01100  Metabolic pathways
vff01120  Microbial metabolism in diverse environments
vff01200  Carbon metabolism
Module
vff_M00165  Reductive pentose phosphate cycle (Calvin cycle)
vff_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:vff00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VITFI_CDS1042
Enzymes [BR:vff01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     VITFI_CDS1042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ASM76820
UniProt: A0A221KDB2
LinkDB All DBs
Position
1111644..1113113
Genome map
AA seq 489 aa AA seqDB search
MNAATDAGVITDAKKRYSAGVLKYRQMGYWDADYVPKDTDTLCLFRITPQEGVDPIEAAA
AVAGESSTATWTVVWTDRLTACDSYRAKAYRVEPVPGRPGEYFAWVAYDIILFEEGSIAN
ITASLIGNVFSFKPLKAARLEDIRMPVALVKTFKGPPTGLVVERERLDKFGRPLLGATTK
PKLGLSGRNYGRVIYEGLKGGLDFMKDDENINSQPFMHWRDRFLYVMDAVNKASAATGEV
KGSYLNVTGATMENIYERAEFAKELGSVVIMVDLIIGWSAIQSIANWARKNDMIVHMHRA
GHGTYTRQKTHGVSFRVMAKWLRLAGVDHLHTGTAVGKLEGDPLTVQGYYNVCRDSYTRQ
DLPRGLFFDQDWADMRKVMPVASGGIHAGQMHQLIDLFGDDVILQFGGGTIGHPAGIQAG
AVANRVALETMVKARNEGKDIKNEGPALLRQAASFCTPLKQALDTWGEISFNYTSTDTSD
FAVTPSTSA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgccaccgatgccggggtgatcaccgacgccaaaaagcgctacagcgccggc
gtgctcaagtaccgccagatgggctactgggacgccgattacgtgcccaaggacacggac
acgctgtgcctgttccgcatcaccccgcaggagggggtcgatccgatcgaggcggcagca
gcggtggcgggcgagtcttcgaccgcgacttggacggtggtctggaccgatcgcctcacc
gcttgcgacagctaccgcgccaaggcttaccgggtcgaacccgtgccggggcgtccgggc
gagtatttcgcctgggtggcttacgacatcatcttgtttgaggaaggttcgatcgccaac
atcaccgccagcttgatcggcaacgtcttcagcttcaagccgctcaaggcggcccgcctg
gaagacatccgcatgcctgtggcgctggtcaagaccttcaaaggcccgcccaccggcttg
gtggtcgagcgtgagcggctggacaagtttggccgtccgctcctgggggccaccaccaag
cccaagctgggcctgtccgggcgcaactacgggcgggtgatttacgagggcctcaagggc
gggctggatttcatgaaggacgatgagaacatcaactcgcagcccttcatgcactggcgt
gaccgcttcctctacgtgatggacgcggtgaacaaagccagcgccgccaccggggaggtc
aagggcagttatctgaacgtgaccggcgcgacgatggaaaacatctacgagcgggccgag
ttcgccaaggagctgggttcggtggtgatcatggtggatctgatcatcggctggagtgcc
atccagtccatcgccaactgggcgcgcaagaacgacatgatcgttcacatgcaccgcgcc
ggccatggcacctacacccgccagaaaacccacggggtgagtttccgggtgatggccaag
tggctgcgcttggccggggtggatcacctgcacaccggcacagcggtgggcaagctggag
ggcgatccgctgacggtgcagggttactacaacgtctgccgcgacagctacacgcgccaa
gacctgccacgcggcctgttcttcgaccaagactgggcggacatgcgcaaggtcatgccc
gtggcttcggggggcatccatgccgggcagatgcaccagttgatcgacctgttcggggac
gacgtgattttgcaattcgggggcggcaccatcggccatccggcgggcatccaggcagga
gcggtggccaaccgcgtggcgctcgaaacgatggtcaaggcccgcaacgaaggcaaggac
atcaagaacgaaggcccggccctcctgcgccaggcggcgagtttttgcacgcccttgaaa
caagcgctcgatacctggggcgagatcagcttcaactacaccagcaccgacacgagcgac
ttcgccgtgacgccctccaccagcgcctga

DBGET integrated database retrieval system