KEGG   Vitreoscilla filiformis: VITFI_CDS2862Help
Entry
VITFI_CDS2862     CDS       T04960                                 

Definition
(GenBank) (NADP(+)) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
vff  Vitreoscilla filiformis
Pathway
vff00020  Citrate cycle (TCA cycle)
vff00480  Glutathione metabolism
vff01100  Metabolic pathways
vff01110  Biosynthesis of secondary metabolites
vff01120  Microbial metabolism in diverse environments
vff01130  Biosynthesis of antibiotics
vff01200  Carbon metabolism
vff01210  2-Oxocarboxylic acid metabolism
vff01230  Biosynthesis of amino acids
Module
vff_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vff_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:vff00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VITFI_CDS2862
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VITFI_CDS2862
Enzymes [BR:vff01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     VITFI_CDS2862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ASM78639
UniProt: A0A221KI97
LinkDB All DBs
Position
complement(3010699..3012939)
Genome map
AA seq 746 aa AA seqDB search
MTTNQQPTIIYTLTDEAPLLATASFLPIIRTFTAPAGINIEKADISVAARVLAEFPEYLS
DRQKVPNTLAELGKKTLEPDANIIKLPNISASVAQLIACVKELQAKGYQIPDYPENPQTD
EEKAIKARYGRCLGSAVNPVLREGNSDRRAPLAVKNYAKKHPHSMGEWKPWSQTHVAHME
HGDFYHGEKSLTLDKPRRVKMELLTASGQTIVLKPEVKLLDGEIIDSMFMSKKALCDFYE
AQLEDCRQSGILFSLHVKATMMKVSHPIVFGHCVKIYYKDAFEKHGALFDELGINVNNGM
VNLYDKIKALPESKRDEIIRDLHACQEHRPRLAMVDSAKGITNFHSPNDVIVDASMPAMI
RQGGKMWGADGKQYDSKCVMPESTFARIYQEMINFCKWHGNFDPKTMGTVPNVGLMAQQA
EEYGSHDKTFEIAEAGVANITDIDTGEVLLTQNVEAGDIWRMCQVKDAPIRDWVKLAVTR
ARNSGMPAVFWLDPYRPHEAELIKKVETYLKDHDTTGLEIRIMSQVRAMRFTLERVARGL
DTISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMNGGGMYETGAGGSAPKHVQQLVQE
NHLRWDSLGEFLALAVSLEELGIKENNARAKLLAKTLDAATGKLLDNNKSPSPKTGQLDN
RGSQFYLAMYWAQELAAQTEDAELAAHFAPLAQSLSEGEAAIVAELSAVQGQPVDIGGYY
KADADKCKAVMRPSATFNAALAAMRA
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaaatcaacagccgaccatcatttacaccttgaccgacgaggccccgctgctg
gcgacggcgtcgttcctgccgatcattcgcaccttcacggcacctgcgggcatcaacatt
gaaaaggccgacatctccgtggccgcccgcgttctggctgagttccccgagtacctgagc
gatcgccaaaaggtgcccaacaccctcgccgaactgggcaagaagacgctggagccagac
gccaacatcatcaagctgcccaacatcagcgcttcggtggcccagttgatcgcctgcgtc
aaggaactgcaagccaagggctaccagatccccgactatccggaaaacccgcaaaccgac
gaagaaaaggccatcaaagcccgctacggtcgttgcctgggttccgccgtgaacccggtg
ctgcgtgaaggcaactcggatcgccgggcccccctggctgtgaaaaattacgccaagaag
cacccgcacagcatgggcgagtggaagccgtggtcgcaaacccacgtcgctcacatggag
cacggggacttctatcacggtgaaaagtccctcaccttggacaagccgcgccgcgtcaag
atggagctgctgaccgccagcggccagaccatcgttctcaagccggaagtcaaactcctg
gacggcgagatcatcgactcgatgttcatgagcaagaaggcgctgtgcgacttctacgaa
gcccagttggaagattgccgtcagtcgggcatcctgttctcgctgcacgtcaaggccacg
atgatgaaggtctcgcaccccatcgtgttcggccactgcgtcaagatctattacaaggat
gcgttcgaaaagcacggcgccttgttcgacgagctgggcatcaatgtcaacaacggcatg
gtgaacctgtacgacaagatcaaggccctgccggagtccaagcgcgacgaaatcatccgt
gacctgcacgcttgccaagagcaccgtccgcgtctggcgatggtggactcggccaagggc
atcaccaacttccactcgcccaacgacgtgatcgtggatgcttcgatgcccgccatgatc
cgccaaggcggcaagatgtggggtgccgacggcaagcagtacgacagcaagtgcgtcatg
ccggaatcgaccttcgcccggatttatcaggagatgatcaacttctgcaagtggcatggc
aacttcgatccgaagaccatgggcaccgtgccgaacgtgggcctgatggcgcagcaagcc
gaagagtacggttcgcacgacaagacgtttgaaatcgccgaagccggcgtggccaacatc
accgacatcgacaccggtgaagtgctgctgacgcaaaacgtggaagctggcgacatctgg
cgcatgtgccaagtcaaggatgcgccgatccgcgactgggtgaagctggccgtgacccgc
gcccgcaactccggcatgccggcggtgttctggctggacccgtaccgtccgcacgaagcc
gagctgatcaagaaggtggaaacctacctgaaggatcacgacaccaccggcctcgaaatc
cgcatcatgagccaagtgcgtgcgatgcgtttcacgctggagcgcgtggcccgtggcctg
gacaccatcagcgtcaccggcaacatcctgcgcgactacctgaccgacctgttcccgatc
atggaactgggcacctcggccaagatgctgtccatcgtgccgctgatgaacggcggtggc
atgtacgaaaccggcgcgggcggttcggcaccgaagcacgtgcaacagttggtgcaggaa
aaccacctgcgctgggattcgctgggtgaattcctggcgctggccgtgtcgctggaagag
ctgggcatcaaggaaaacaatgcccgcgccaagctgctggccaagacgctggacgccgcc
accggcaagctgctagacaacaacaagtcccccagccccaagaccggccaactggacaac
cgtggcagccagttctacctggccatgtactgggcccaagagctggccgcgcaaacggaa
gatgccgaactggccgcccactttgcgccgctggcccagagcctgagcgaaggcgaagcc
gccatcgtggccgagttgagcgctgtgcaaggccagccggtggacatcggcggctactac
aaggccgacgccgacaagtgcaaggccgtgatgcgcccgagcgccaccttcaacgctgcg
ctggctgcgatgcgcgcttga

DBGET integrated database retrieval system