KEGG   Aliivibrio fischeri ES114: VF_0892Help
Entry
VF_0892           CDS       T00236                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00250  Alanine, aspartate and glutamate metabolism
vfi00410  beta-Alanine metabolism
vfi00430  Taurine and hypotaurine metabolism
vfi00650  Butanoate metabolism
vfi01100  Metabolic pathways
vfi01110  Biosynthesis of secondary metabolites
vfi01120  Microbial metabolism in diverse environments
vfi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VF_0892
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VF_0892
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VF_0892
   00430 Taurine and hypotaurine metabolism
    VF_0892
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VF_0892
Enzymes [BR:vfi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VF_0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DUF5446
Motif
Other DBs
NCBI-GeneID: 3277990
NCBI-ProteinID: YP_204275
UniProt: Q5E6F9
LinkDB All DBs
Position
I:complement(981246..982889)
Genome map
AA seq 547 aa AA seqDB search
MVTDNKTADASFESLLRIFTVPEAPDSTLGIIEKELSQNLNQFLREHIVAEEKPLTEIEK
DFTDSSMPESPTYVSEHTEHLLDTLVSQSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIFGQKDSFYQHWMHSADHSLGAFCSGGTIANITA
LWVARNRLLKPEGDFEGIAKQGLFAALMHYKCNGLAIFVSERGHYSLKKAADVLGIGQDG
VIAVKTDNNNRVCLDDLELKIAQAKAKNIKPLAIVGVAGTTETGSIDPLRELANVAQREG
CHFHVDAAWGGATLMSNTYRHLLDGIDLADSVTIDAHKQLYVPMGAGMVIFKDPELMSSI
QHHAEYILRKGSKDLGRHTLEGSRSGMAMLLYSCFNVISRPGYELLINQSIEKAHYFADL
IQQQDDFELITEPELCLLTYRYVPSNVKAALAIATDEQKIEIYEHLDNLTKYIQKTQRET
GKSFVSRTRLTPEAYQHQPTIVFRVVLANPLTTKEILQNVLIEQREIASSSEISLPLLNQ
IVGNILH
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggtaacagacaacaaaacagcagatgcgagctttgaaagcctgctgcgaatttttact
gttccggaagctcccgattcgactcttggaataattgaaaaagaactttcacagaactta
aatcaatttttgagagagcatattgttgccgaagaaaagccattgacggaaatcgaaaaa
gattttaccgattcatcaatgcctgaatcgccaacctatgtatccgaacatactgagcac
ctgttagatacccttgtatctcaatccgttcatacctctgcaccaagctttattggccac
atgacatcggcattgccttactttttaatgccactttcaaaaatcatgattgccctaaac
caaaacttggtaaaaattgaaacatcaaaagcatttaccccattagagcgtcaagtgctt
ggtatgttgcaccgtctaatttttggtcaaaaagacagtttctatcaacactggatgcac
agcgctgatcattctctgggtgctttttgttcaggcggcaccattgccaatattacagcg
ttatgggttgcaagaaatcgcctattaaaaccagaaggtgattttgaaggtattgccaaa
caaggactttttgccgctcttatgcattataagtgcaatgggttagctattttcgtttca
gaacgtggtcactactcactcaaaaaagcagccgatgtattagggattggtcaagatggt
gttattgccgtaaaaactgacaacaacaaccgtgtttgccttgatgatttagagcttaaa
attgcccaagcaaaagcgaaaaacattaagccattggctattgttggggttgcaggaacc
acagaaacaggttcaattgacccacttcgtgagttagcaaatgttgctcaacgtgaagga
tgtcatttccatgtggatgccgcttggggcggtgcaacattaatgtcgaatacgtaccga
caccttttagatggtattgatttagccgattccgtaacgattgatgcacacaagcaacta
tacgtgccaatgggggcaggtatggttatttttaaagatcctgagttaatgtcttctatc
cagcatcatgctgaatacattcttcgtaaagggtctaaagatttaggtcgtcacacactt
gaaggttctcgaagtggtatggcgatgttgctttattcttgtttcaacgtgatcagtcgc
cctggttatgaattattaatcaaccaaagtattgaaaaagcacactactttgctgattta
attcaacagcaagatgactttgaactgataacagagcctgagctgtgtttgctgacttat
cgttatgttccaagtaatgtaaaagcggcactggccattgcgactgacgagcaaaagatt
gagatttatgaacacttggataatctcaccaagtacattcaaaaaacgcaacgtgaaact
gggaaatcttttgtttctcgaactcgattaacacctgaagcttatcagcatcaaccaacc
atcgttttcagagtcgtattggcaaacccattaacaacaaaagaaatactgcaaaatgtc
ttaattgagcaaagagaaattgcgagcagcagtgaaatatctttacctcttttaaaccaa
attgtaggcaacattcttcactaa

DBGET integrated database retrieval system