KEGG   Aliivibrio fischeri ES114: VF_0921Help
Entry
VF_0921           CDS       T00236                                 

Gene name
sodB
Definition
(RefSeq) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vfi  Aliivibrio fischeri ES114
Brite
Enzymes [BR:vfi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VF_0921 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 3278258
NCBI-ProteinID: YP_204304
UniProt: Q5E6D0
LinkDB All DBs
Position
I:complement(1016766..1017350)
Genome map
AA seq 194 aa AA seqDB search
MSFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLAPNAGGEPTGAVAEAINAAFGSFEEFKAQFTDSAINNFG
SSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDFRNVRPDYMGAFW
NLVNWSFVEENLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttgaattaccagctctaccgtatgcaaaagatgcactagaaccacatatctca
gcagaaacactggatttccaccacggtaaacaccacaacacatacgttgttaaactaaac
ggtcttatccctggtactgagtttgaaggtaaaacactagaagagatcattaaaacttct
actggtggtgttttcaataacgcagcacaaatctggaaccacacgttctactggcactgt
ttagctccaaacgctggtggcgaaccaactggtgctgtagcagaagctatcaacgctgca
ttcggttcttttgaagaatttaaagctcaattcacagattcagcaatcaataactttggt
tcttcttggacttggttagtgaaaaaagcggacggttctctagaaatcgttaacacgtct
aacgcagcaacaccactaacagaagaaggtacaacaccacttctaacagttgacctgtgg
gaacacgcttactacatcgatttccgtaatgttcgtcctgattacatgggtgcattctgg
aaccttgtaaactggtctttcgtagaagaaaacctagcaaaataa

DBGET integrated database retrieval system