KEGG   Aliivibrio fischeri ES114: VF_1292Help
Entry
VF_1292           CDS       T00236                                 

Gene name
fabA
Definition
(RefSeq) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
vfi  Aliivibrio fischeri ES114
Pathway
vfi00061  Fatty acid biosynthesis
vfi01100  Metabolic pathways
vfi01212  Fatty acid metabolism
Module
vfi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:vfi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    VF_1292 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vfi01004]
    VF_1292 (fabA)
Enzymes [BR:vfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     VF_1292 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     VF_1292 (fabA)
Lipid biosynthesis proteins [BR:vfi01004]
 Fatty acid synthase
  Component type
   VF_1292 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-GeneID: 3278628
NCBI-ProteinID: YP_204675
UniProt: Q5E5A9
LinkDB All DBs
Position
I:complement(1442693..1443211)
Genome map
AA seq 172 aa AA seqDB search
MQNKPSSYDREDLLASSRGELFGPNGPQLPAPNMLMMDRIPLMSETEGAFGKGKVIAELD
ITPDLWFFDCHFPGDPVMPGCLGLDAMWQLVGFFLGWIGGEGKGRALGVGEVKFTGQVLP
TAKKVTYEIDFKRVINRKLVMGLADGRVLVDGKEIYVAKDLKVGLFQDTSAF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacaaacctagttcttatgatcgcgaagatttactagcatcaagccgtggcgaa
ttatttggcccaaatggtccacaactaccagcaccaaacatgctaatgatggatcgtatc
cctctgatgtctgaaactgaaggcgcatttggtaaaggtaaagtgatcgcagagttagat
attactccagatctttggttctttgattgtcacttccctggcgacccagtaatgcctggc
tgtcttggccttgatgctatgtggcaattagttggtttcttccttggctggattggcggc
gaaggtaaaggtcgagctttaggtgtgggtgaagttaaattcacaggccaagtacttcct
actgcgaaaaaagtaacttacgaaatcgatttcaaacgtgttattaaccgtaaactggtt
atgggcctagctgatggtcgtgtacttgttgatggtaaagaaatctacgttgcaaaagac
cttaaagttggtcttttccaagatacatctgcattctaa

DBGET integrated database retrieval system