KEGG   Vibrio fluvialis: AL536_04350Help
Entry
AL536_04350       CDS       T04379                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
vfl  Vibrio fluvialis
Pathway
vfl00564  Glycerophospholipid metabolism
vfl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vfl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AL536_04350
Enzymes [BR:vfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AL536_04350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_oxidored K_oxygenase Pyr_redox_2 3HCDH_N FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AMF92710
UniProt: A0A0X8LIT0
LinkDB All DBs
Position
1:947898..949448
Genome map
AA seq 516 aa AA seqDB search
MKQNLSSTRFTENEVLDIIIVGGGINGAGIAADAAGRGLKVGMYEAQDFAGATSSASSKL
IHGGLRYLEHYEFRLVSEALAEREVLLKKAPHIVKPMRFRLPHRPFLRPAWMIRIGLFLY
DNLGKRTSLPASKKVALKAGEVMKPEMKIGFEYSDCWVDDARLVILNAIQAQELGSEVMN
YCRVEHASRDGDIWTVTLFDERTQQRFVRKSHALVNATGPWVKQFLDESIHVRSPYGIRL
IKGSHIIVPKIHNEEQAYILQNEDQRIVFVIPYLGKYSMIGTTDVEYKGDPRKVAISQEE
RQYLVDIVNKHFVREISTSDIVSEFSGVRPLCDDESNSPQAITRDYTLSLDQQGEEAPLL
SIFGGKLTTYRKLAESAMKHLSPFFPNMKTNWTNESTLPGGEDYVYGNIRNELKRQYPFV
NDATLDRWLTCYGSRTRKLLADVASIEDLGTQFSDTLFQREVDYLIENEYAYKVDDIFWR
RSKLGIDHDSATIEQVAQYLAKCHSSHVEPALKAVI
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaacttaagctcaacacgttttactgaaaatgaagtgctcgacatcatcatt
gttggtggtggtatcaatggcgcaggtatcgcagccgacgctgcgggtcgtggactgaaa
gtgggtatgtatgaagcgcaggattttgccggcgcaacctcttctgccagctctaagctt
atccatggtggtctgcgctatcttgagcattatgagtttcgtttagtgagtgaagcactt
gccgagcgtgaagttctgttgaaaaaagcgcctcacattgtaaagccgatgcgttttcgt
ttgccgcatcgcccgttcctgcgtccagcctggatgattcgtattggtctgttcctgtac
gacaacttgggtaaacgtacttctttgccagcgagtaagaaagtcgcgctaaaggcaggc
gaagtaatgaaaccggaaatgaaaattggctttgaatattcagattgctgggtcgatgac
gctcgtttggtgattctgaacgcgattcaagctcaagagctgggttcagaagtgatgaac
tactgccgcgtcgaacacgcaagccgcgacggcgatatctggacagtgacactgtttgat
gagcgtacacaacaacgtttcgtgcgtaagagtcacgctctggttaacgcaacggggcct
tgggttaagcagtttttggacgaaagcatccatgttcgctccccttacggcattcgcctg
atcaaaggctcacacattatcgtgccgaagattcataacgaagaacaggcgtacattctg
cagaatgaagaccagcgtatcgtattcgtgattccgtacctgggtaaatactcgatgatc
ggtaccactgacgtggaatacaaaggcgacccgcgcaaagtggcaatttcgcaggaggag
cgccagtatctggtcgatatcgtcaataaacactttgtacgcgaaatcagcacatcagac
atcgtatctgaattcagcggtgtgcgtcctttgtgtgatgatgaatccaactcaccacaa
gcgatcacgcgtgactacacgctgtcgttggatcaacaaggtgaagaagcaccactactg
tctatctttggcggtaaactgaccacataccgtaaactggctgagtccgcgatgaagcat
ttgtcgccattcttcccgaacatgaaaacaaactggaccaacgaatctacactgccaggc
ggcgaagattatgtgtacggtaacatccgtaacgaactgaaacgtcagtacccgttcgtc
aacgatgccacgctggatcgctggctaacttgttacggcagccgtacccgaaaactgctg
gccgatgtcgcatccattgaagatctgggtacccagttcagcgatacgctgttccaacgt
gaagtggactacctgattgaaaacgaatatgcctacaaagtggatgatattttctggcgt
cgcagcaaattgggtatcgatcacgacagtgccacgattgaacaggttgctcaatacctt
gcaaagtgtcactcctcacacgttgagcctgccctcaaagccgtgatttaa

DBGET integrated database retrieval system