KEGG   Vibrio fluvialis: AL536_05260Help
Entry
AL536_05260       CDS       T04379                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vfl  Vibrio fluvialis
Brite
KEGG Orthology (KO) [BR:vfl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AL536_05260
Enzymes [BR:vfl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AL536_05260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 Thioredoxin_3 FAD_oxidored GIDA HI0933_like FAD_binding_2 Glutaredoxin DAO FAD_binding_3 Thioredoxin_9 AlaDh_PNT_C NAD_binding_8 Thi4
Motif
Other DBs
NCBI-ProteinID: AMF92878
UniProt: A0A0X8LJ11
LinkDB All DBs
Position
1:1122829..1124397
Genome map
AA seq 522 aa AA seqDB search
MLDQAIKQQLQQYLTNLKEDVRLVVSLDESKGSQDILALANEIAELSPLISVERDDAASD
RKPVMTVTNPNKGTQLRFAGVPMGHEFTSLVLALLHSGGHPIKLEQETIDQIAKLGKKLD
VEVFISLSCQNCPDVVQAFNMMAAINPDIRATMIDGALFQDEVKNRDIMAVPSVFINGEL
FGQGRMTLTEILNKLDDGAAEKAAASLNEKDPYDVLVVGGGPAGAAAAIYAARKGIRTGI
VAQRLGGQVMDTMAIENFISVKHTEGPKLAANLGEHLKEYGVDIITEQQAEKLMGAEFTT
DGKIHVSLQSGATLKSNSVILSPGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADVLRADQVLINKANSMPNIDIITMAQTTEVVG
DGTRVTGLKYKDRHTDEIKQLELSGIFVQIGLVPNTEWLKDSAVELSARGEIEIGSRGET
SMDGVFAAGDATTVPYKQIIIAMGEGAKASLGAFDYLIRKQS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctagaccaagcgatcaagcaacagttacaacagtatctgacaaatttaaaagaagac
gtccgtttagtggtcagcctagatgaaagcaaaggctcacaagacattctggcactggcc
aatgaaatcgctgaactcagcccactgatcagcgtagaacgtgacgatgccgcgagcgat
cgcaaaccagtcatgacagtgaccaacccaaacaaaggtacacagctgcgttttgctggt
gtgccgatgggccacgaatttacttctctggttctggcgctgcttcactctggcggtcac
ccaatcaaactggagcaagaaacgattgatcaaatcgcgaaactcggcaaaaagctcgac
gtcgaagtgttcatttctctgtcttgccaaaactgtcctgacgtagtgcaagcgttcaac
atgatggcggcgatcaacccggacatccgcgccaccatgattgacggcgctctgttccag
gacgaagtgaaaaatcgcgacatcatggccgttccaagtgtattcatcaacggtgaactg
tttggtcaaggccgtatgactctgactgaaatcctgaacaaactggatgacggcgcagca
gaaaaagcagccgcaagcctcaacgaaaaagacccatacgatgtacttgtggtcggcggt
ggcccagcaggtgcagcggctgcgatttacgcagcacgtaaaggcattcgcacgggtatc
gtggcgcagcgtttgggtggtcaggtgatggacaccatggcgatcgaaaacttcatctcc
gtgaaacacacggaaggtccaaagctggcggcgaatttgggtgaacacctgaaagagtac
ggcgtggacatcatcactgagcagcaagctgagaagctgatgggcgctgagttcacaaca
gatggcaaaatccacgtgagcctgcaaagcggcgcgacactgaaaagtaacagtgtcatc
ttaagcccgggggctcgctggcgtgaaatgaacgttcctggcgaacaagaataccgtaac
aaaggtgtagcgtactgcccgcactgtgacggcccgctgttcaaaggcaagaaaaccgcg
gttatcggtggtggtaactcaggtattgaagcggctatcgacctggcgggtatcgtcgaa
cacgtgaccgtactggaatttgctgacgtactgcgtgcagaccaagtactgattaacaag
gcgaattcaatgccaaacatcgacatcatcacgatggctcagacaaccgaagtggtgggt
gatgggactcgtgtgacaggcttgaaatacaaagaccgccacacggatgaaattaagcag
cttgaactgtctggtatcttcgttcaaatcggtctggtgcctaacaccgaatggctgaaa
gattcagcagttgaactttctgcccgtggcgagattgaaatcggcagccgcggcgaaacg
agcatggatggtgtgtttgctgcaggtgacgcaacgacagtcccttacaaacagatcatc
attgcgatgggtgaaggtgcgaaagcaagcttaggcgcgtttgactacctaatccgcaaa
caaagttaa

DBGET integrated database retrieval system