KEGG   Vibrio fluvialis: AL536_06685
Entry
AL536_06685       CDS       T04379                                 

Definition
(GenBank) type VI secretion system protein TssA
  KO
K11910  type VI secretion system protein VasJ
Organism
vfl  Vibrio fluvialis
Brite
KEGG Orthology (KO) [BR:vfl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vfl02044]
    AL536_06685
Secretion system [BR:vfl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AL536_06685
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N Peptidase_M16
Other DBs
NCBI-ProteinID: AMF93130
UniProt: A0A0X8LJI7
LinkDB
Position
1:complement(1440981..1442381)
AA seq 466 aa
MEITEYRRCVAQPIAGDNPVGERLIDDPLFDFIEDQMMKVGSLSHSSVQWDEVEHSALKL
LQDKTKDIKLMVYLLQCLHNQLSPSRFILSFELMSDFMASFWEESYPAPGKRGNLPRRKF
FSQIAQRFSMATEKIDFNQFDAQDRQALGEAVDAWKKIIEAQGLSSDVVEAVARSVQSEL
NKVEARQQAEQQQTAKPADTPRPTTANSALSVDNSSDKAAKQTLLKVADFLAEQEFGIAL
SIRLRRYAVWGSITTLPDHKADGETMLRGMQQDRIKDYQDQMRHADLTLWRKVEQSLTLS
PYWFDGQLMSFTIAQNLGKESWCLAITEETQQFLARMPSLLELKFKGGEPFVSDSVKEWL
ASGNGSTGGQSVGGDWQEKRKEAMALAKEGGIAVALSMLNDGLVAATEPRDKFYWRMLSA
DLLNANHLDAMAKEQYQTLHNQVTTMQVTDWEPSLVEQLERYTTSE
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggaaataaccgaataccgccgctgtgtggcacagccgattgctggagataatccggtc
ggtgaacgtttgattgacgatcccctgtttgacttcattgaagatcagatgatgaaagtc
ggctcactgtcgcatagcagcgtgcagtgggacgaagtggaacacagtgcgctgaaatta
ctgcaggacaagaccaaagacatcaagctgatggtgtatctgctgcaatgccttcacaac
caactttcgccttcccgttttattctctcatttgaactgatgagcgattttatggcgtct
ttctgggaagaaagttaccccgcaccgggcaagcgcggcaatctgccaagacgcaaattt
ttcagtcagattgcgcagcgtttttcgatggcgacggaaaaaatcgattttaatcagttt
gatgcgcaggaccgccaagcattaggtgaggcggtggatgcgtggaaaaaaatcattgaa
gcgcaagggctgagttcggatgtggtcgaagcggtcgctcgctcggttcagagtgaactg
aataaagtggaagcgcgtcagcaagccgagcagcagcaaacggccaagcctgcagatacg
ccgcgcccgaccacggccaactcagccttgtcggtggataattccagtgacaaagcggcc
aagcaaacgctgctcaaagtcgcggattttcttgctgagcaggagtttggcattgcgctg
tcgattcgcctgcgccgttatgccgtttggggttcgattactacgctgccggatcacaaa
gccgacggtgaaaccatgctgcgcggtatgcagcaagatcgaattaaagattatcaggac
cagatgcgccatgcggatctgacactctggcgcaaggtcgagcagagcctcacgctctcc
ccgtactggtttgacggccaactgatgagtttcaccattgcgcaaaacttgggcaaagag
agctggtgtctggctattactgaagaaacgcaacaatttctcgcccgaatgccttcgctg
ctggaactcaaattcaaagggggcgaaccgtttgtctccgacagcgtgaaggagtggctg
gcatccggcaacggctcgactggcgggcaaagtgtgggcggtgattggcaggaaaagcgc
aaagaagcgatggctttggctaaggaaggcggcatcgcggtcgccttgtcgatgctcaat
gatggcctagtggcagccacggaaccgcgcgacaaattttactggcggatgctctctgcc
gatctgctcaacgccaatcatctcgatgcgatggcgaaagagcagtaccaaactttacat
aatcaagtcaccaccatgcaggtcaccgattgggagccgtcgctggtggaacaactagaa
cgatatacaacgtcagagtaa

DBGET integrated database retrieval system