KEGG   Vibrio fluvialis: AL536_08435Help
Entry
AL536_08435       CDS       T04379                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
vfl  Vibrio fluvialis
Pathway
vfl00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vfl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AL536_08435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:vfl01002]
    AL536_08435
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vfl01011]
    AL536_08435
Enzymes [BR:vfl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AL536_08435
   3.4.21  Serine endopeptidases
    3.4.21.-  
     AL536_08435
Peptidases [BR:vfl01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   AL536_08435
Peptidoglycan biosynthesis and degradation proteins [BR:vfl01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AL536_08435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Response_reg
Motif
Other DBs
NCBI-ProteinID: AMF93564
UniProt: A0A0X8LKD9
LinkDB All DBs
Position
2:complement(181372..182814)
Genome map
AA seq 480 aa AA seqDB search
MSLFQPRQFCVVSFSLYCVFFSVAGSAQLNTQSLPNGARTGLLIQSLNNAEPSERLQTGE
YFPPASTLKVITALASQLELGPDFRFETTLAVSGNNAALVFSGDPTLKTDDVKTLLRALK
QQQGSTITGDLWLDNRRFTGYERAVGWPWDVMGVCYSAPVSTINLDGNCIQASIYTQDDG
RTRVFVPEHYPVHVISEARSVSDTEQQSQHCDLELTTSPENHYRLAGCLPSRTKPLPLKF
AVQNTDLYAQRLVYKLLNQLGITLKGEVRIGALPGKTAQVIATHQSESLTQLLDTMLKDS
DNLIADTLTKTLGHHFFLQPGSFTNGTEAIKQIIFARTGISLADAQLTDGSGLSRNNRIR
LDSMRQILIYVWQHDQELGLIDLLPVAGESGTLKYRRSMRSDEVKGKIKGKSGSLYGTHN
MVGFGLDKQGKPETLFIQYVTDYFPPESQTELPVEAPITQFESGFYHQVLSLSQAHDSRQ
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtctttatttcaaccccgacaattctgtgtcgtttccttctccctgtactgtgttttc
ttttccgtagcgggttcggcgcagctaaacacgcaatctttaccgaacggcgctcgcact
gggctgcttatccagtcgctcaataacgcagagccgagtgaacgtctgcaaaccggagag
tattttccgccagccagcacattaaaagtgatcaccgcattagcgagccagttagagtta
gggccggattttcgctttgaaacgacattagccgtttccggaaataacgcagcgctggtg
ttcagtggagatcccacgctcaaaaccgacgatgtgaaaacactgctcagagcactcaaa
caacagcaaggatcgaccatcacgggcgacttatggcttgataatcgccgctttaccgga
tacgagcgcgcggtcggttggccctgggacgtcatgggcgtatgttacagtgctccggtc
agcacgattaatcttgatggaaactgcattcaggcatccatttatactcaggatgatggc
cgaacccgcgtattcgttcctgagcattacccggtacatgtgatttccgaagcccgcagc
gtgagcgataccgaacaacaaagccagcattgcgatttagagctcaccacatcaccggaa
aaccattatcgtctcgcaggctgcctgcccagtcgaacaaagcctctaccgctgaaattc
gccgtgcagaatacagatttgtatgctcagcgtctggtgtataaattgctcaatcaattg
ggcatcactttaaaaggtgaagtaagaattggcgctctgcccggaaaaaccgctcaagtg
attgccactcaccaatccgaaagcctgactcagctattggataccatgcttaaagattct
gacaatctgattgctgacacgctgaccaaaacgctaggacaccattttttccttcaacca
ggcagctttaccaacggtaccgaagcgatcaaacagatcatttttgcgcgtacaggcatt
tcactggctgacgcacagctcaccgacggatccggcttatcacgcaacaaccgaattcgt
ctcgacagcatgcgccagatcctcatctacgtctggcaacacgatcaggaattagggctt
atcgatttgcttcctgttgctggtgagagtggcacactcaaatatcgccgcagcatgcgc
agcgatgaagtgaaaggcaagatcaaaggtaagagtggttcgctgtacggtacacacaac
atggttggtttcggactggacaaacagggcaagccggagacactgtttattcagtatgtc
accgactatttcccgccagagtcccaaactgagcttccggtcgaagcccccattactcag
tttgagtccggattttatcatcaggttctcagcctaagccaagcacatgattcacgacag
taa

DBGET integrated database retrieval system