KEGG   Vibrio fluvialis: AL536_10230Help
Entry
AL536_10230       CDS       T04379                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vfl  Vibrio fluvialis
Brite
Enzymes [BR:vfl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AL536_10230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AMF93876
UniProt: A0A0X8LKY2
LinkDB All DBs
Position
2:complement(542036..542620)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLSPNGGGEPTGAVADAINAAFGSFEEFKAKFTDSAINNFG
SSWTWLVKKADGSLAITNTSNAGTPLTEEGVTPLLTVDLWEHAYYIDYRNVRPDYMNGFW
ALVNWEFVAANLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaattaccagctcttccttacgctaaagacgcactggaaccacacatctct
gcagagactcttgattaccaccacggtaagcaccacaacacttacgttgttaagctgaac
ggtctgatccctggtactgagtttgaaggtaaaactctggaagagatcatcaagacttca
actggcggtgtattcaacaacgcagcgcaaatctggaaccacacgttctactggcactgt
ctgtctccaaacggcggcggcgaaccaactggcgcagtagcggatgcaatcaacgcagca
ttcggttctttcgaagagttcaaagcaaaattcactgactcagcaatcaacaacttcggt
tcatcttggacttggcttgtgaagaaagcggatggctctctggctatcactaacacttct
aacgcaggtactccactgactgaagaaggcgtcactccactgctgactgttgacctgtgg
gaacacgcgtactacatcgattaccgtaacgtacgtccagattacatgaacggtttctgg
gctctggttaactgggaattcgttgcagctaacctggctaaataa

DBGET integrated database retrieval system