KEGG   Vibrio fluvialis: AL536_14800Help
Entry
AL536_14800       CDS       T04379                                 

Definition
(GenBank) anthranilate synthase component 1
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
vfl  Vibrio fluvialis
Pathway
vfl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vfl01100  Metabolic pathways
vfl01110  Biosynthesis of secondary metabolites
vfl01130  Biosynthesis of antibiotics
vfl01230  Biosynthesis of amino acids
vfl02024  Quorum sensing
Module
vfl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vfl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AL536_14800
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    AL536_14800
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AL536_14800
Enzymes [BR:vfl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     AL536_14800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AMF94716
UniProt: A0A0X8LMJ7
LinkDB All DBs
Position
2:1537541..1539106
Genome map
AA seq 521 aa AA seqDB search
MNKAIEIKNLAKLEVLNATLPYTQDPTALFHALCEGKTDCLLLESAEIDSKQNLKSLLLI
DAAVRIICFGHEVTFQALSDNGLALIDVLAQNVVADIPAKRTDDSLTLTFTTPCDTLDED
SRLREASSFDALRLVQHSFDLSGHDKHAIFLGGLFAYDLVANFEPLGDAKATNQCPDYVF
YVSENLMIVDHQSASCQLQATAFTTDSNVKATLRQRQEAIRAQASQALSQPEAQKLAEVN
VDTSISDEDFCDIVRDLKQYVVKGDIFQVVPSRRFTLPCPSPLAAYQRLKESNPSPYMFY
MQDERFTLFGASPESALKYATDTNQIEIYPIAGTRRRGKNADGSINFDLDSRIELELRCD
KKENAEHMMLVDLARNDVARIAKAGSRHVADLLKVDRYSHVMHLVSRVVGQLREDLDALH
AYQACMNMGTLTGAPKIRAMQLIREVEQERRGSYGGAVGYLTGEGDLDTCIVIRSAFVEN
GIAQVQAGAGVVYDSDPQAEADETRGKAQAVISAIQFAHQA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaggccattgaaatcaaaaatctggcaaagcttgaagtactcaacgcaacgcta
ccttacacgcaagatccaacggcgctgtttcacgcactgtgcgaagggaaaacggattgc
ttgttactggaatcagcggagatcgactccaaacagaacctgaagagcctgctgctgatt
gatgctgccgtacgcattatctgcttcggtcatgaagtgacatttcaggcgctaagcgat
aacggtcttgccctgattgatgttctggcgcaaaacgttgtggcagatatcccggccaaa
cgcaccgatgactctctgacgctgactttcaccacgccatgcgatacgttggatgaagac
tctcgcctgcgtgaagcttcatcgtttgacgcattgcgcctggtgcagcacagctttgat
ttgtcgggtcacgacaaacacgcgattttccttggtggtctgttcgcttacgacttggtg
gccaacttcgaaccgcttggcgacgcaaaagcgaccaatcagtgcccggattacgtattt
tatgtctccgagaacctgatgatcgttgatcaccagagtgcaagctgtcagttgcaggcc
actgcatttacgaccgacagcaatgtgaaagcgacactgcgtcagcgtcaggaagccatt
cgtgctcaggcgtcgcaggctctgtctcagccagaggcacaaaaactggctgaagtgaac
gtggacaccagcatcagcgatgaagatttctgcgatatcgtacgcgatttaaaacagtat
gtggtgaaaggcgatatcttccaggtcgtgccttcacgccgcttcacgctgccttgccct
tctccacttgcggcttatcagcgcctgaaagaaagcaacccaagcccttacatgttctac
atgcaggatgagcgctttaccctgtttggtgcctctccggaaagcgcgttgaaatacgcc
actgataccaaccaaatcgagatttacccaattgccggcacgcgtcgccgcggaaaaaat
gctgatggttcgattaactttgacctcgacagccgcattgaactggagctgcgctgcgat
aaaaaagagaacgccgaacacatgatgctggtcgatctagcgcgtaacgatgtagcacgt
atcgccaaagctggcagccgccatgtggcggatctgctcaaagttgaccgctacagccat
gtgatgcatctggtgtcacgcgtggtgggccaactacgtgaagatttggatgcgctgcat
gcttatcaagcgtgtatgaatatgggtaccctgactggcgcaccgaaaattcgcgccatg
caactgattcgtgaagtggaacaggaacgccgcggtagctacggcggcgcggtcggttac
ctgaccggtgaaggcgacttggacacctgtattgtgattcgctctgcgtttgtcgaaaac
ggcattgctcaggttcaggctggcgctggcgttgtttacgactccgatccacaggccgaa
gccgatgaaactcgcggcaaagcacaagcggttatttccgccattcaatttgcccatcag
gcgtaa

DBGET integrated database retrieval system