KEGG   Vibrio fluvialis: AL536_21760Help
Entry
AL536_21760       CDS       T04379                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vfl  Vibrio fluvialis
Pathway
vfl00620  Pyruvate metabolism
vfl00680  Methane metabolism
vfl01100  Metabolic pathways
vfl01120  Microbial metabolism in diverse environments
vfl01200  Carbon metabolism
Module
vfl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL536_21760
  09102 Energy metabolism
   00680 Methane metabolism
    AL536_21760
Enzymes [BR:vfl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AL536_21760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF29 DUF349 HAMP
Motif
Other DBs
NCBI-ProteinID: AMF95959
UniProt: A0A0X8LPX7
LinkDB All DBs
Position
2:complement(3037363..3039996)
Genome map
AA seq 877 aa AA seqDB search
MNEKYAALKSNVSMLGRLLGQTIQDADGDVILEKVETIRKLSKSARAGNQADRENLIEEI
KSLNNDELTPVARAFNQFLNLTNIADQYHTISRHCEEHVCEPDAVHSLFSKLSQNGISKL
DTAQAVRDLNIELVLTAHPTEITRRTMINNLVKINECLSKLELSDLSSKERLKTERRLEQ
LIAQGWHSDVIRKQRPTPLDEAKWGFAVVENSLWQAVPEFLRELNESVKEYLDEGLPIDA
RPVHFSSWMGGDRDGNPFVTHSITREVMLLSRWKAADLYLGDINELVAELSMTKCNDALR
ALAGEEEHEPYRAVLKRVRSLLQETLEILDAKIHGQKLAVKAPLQNVSQLWDPLYACYQS
LHECGMGVIADGSLLDTLRRVKAFGVHLVRLDIRQESTRHADALSELTRYLGIGDYNQWS
EQDKIAFLTNELASKRPLLPRDWEPSAPVKEVFDTCKIVAAQPREAFGAYVISMARTASD
VLAVHLLLQESGCPYRMDVCPLFETLDDLNNAEKVITQLMGIDLYRGFIQNHQMVMIGYS
DSAKDAGVMAAGWAQYHAMESLVKVAEEAGVELTLFHGRGGTIGRGGAPAHAALLSQPPK
SLKGGLRVTEQGEMIRFKLGLPEVAVNSFSLYASAVLEANLLPPPEPKQEWRDLMNVLSE
VSCEAYRAVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPNGGVESLRAIPWIFSWS
QNRLVLPAWLGAGEAIQYSIDKGHQALLEEMCREWPFFSTRLGMLEMVYTKCNMDIARYY
DERLVDESLRPLGQRLRDQLQKDIKTVLNVENNENLMQSDPWGHESIRLRNIYVEPLNML
QAELLYRTRQSQDADPELEEALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaatacgccgcgctcaaaagtaacgtgagcatgctcggtcgactactgggt
cagactatccaggatgcggatggtgacgttattttagagaaagtggagaccatccgaaaa
ctttctaaatctgcccgcgccggcaatcaagctgatcgtgagaatctcattgaagagatt
aaaagcctgaataacgatgagctgactccggtcgctcgcgccttcaaccaattcctgaat
ctgaccaatatcgccgatcagtaccacaccatttcgcgtcattgcgaagagcatgtgtgt
gaaccggatgcggtgcattcgctgttcagcaaactgagtcagaacggcatcagcaagctg
gataccgcgcaggcggttcgcgatctgaatattgaactggtattgactgcgcacccgacg
gaaatcacccgtcgcaccatgatcaacaatctggtaaaaattaacgaatgtctgtccaaa
ctggaactgagcgatctttcttctaaagaacgcctaaaaactgagcgtcgtttagaacag
ttgattgcccagggctggcattctgatgtcatccgtaaacagcgtccaaccccgctggat
gaagccaaatggggcttcgctgtggttgagaattcactgtggcaagccgtgccagaattt
ttgcgtgaactgaatgagagcgtgaaagagtatctggacgaaggcctgcctatcgatgcc
cgcccagtgcacttctcatcgtggatgggcggtgaccgcgacggcaacccgtttgtcacc
cactccatcacacgtgaagtgatgctcctgtcgcgctggaaagccgcggacctttatcta
ggtgacattaacgagctggttgccgagctgtcgatgaccaagtgcaatgatgcgctgcgc
gcgctggctggtgaagaagaacatgaaccgtaccgcgcggtactgaaacgcgttcgttcc
ctgcttcaggaaacactggaaattctggatgcgaaaattcacggccagaagctggcagtg
aaagcaccgctgcagaatgtcagccagctgtgggaccctctgtacgcgtgttaccaatcc
ctgcatgaatgtggcatgggcgtgatcgccgacggctcactactcgataccctgcgccgc
gtcaaagcgttcggtgttcatctggtgcgcctcgacattcgtcaggaaagtactcgccac
gccgatgcgctgtctgaactgactcgttaccttggtatcggtgattacaatcagtggagc
gaacaggataagattgccttcctgaccaacgaactggcctcaaaacgtccgctgttgccg
cgtgactgggagccgtcagcaccggtcaaagaagtgttcgacacctgtaaaatcgttgcc
gcgcagccgcgtgaagcgtttggcgcttacgtcatttcgatggcgcgcaccgcatccgac
gtgttggcggttcacctgctgctgcaagaatccggctgcccttaccgtatggacgtatgt
ccactgtttgaaacgctggacgacctcaataacgctgaaaaagtcattacccaactgatg
gggattgatctgtaccgtggcttcattcagaaccatcagatggtgatgattggctactct
gactcagccaaagatgccggcgtcatggcggcgggatgggctcagtaccacgcgatggaa
tcactggttaaagtggccgaagaagcgggtgttgaactgaccctgttccacggccgtggt
ggtaccattggtcgtggcggcgcccctgcgcacgcagcactgctgtctcagccaccgaaa
agcctcaaaggcggtctgcgcgtgacggaacagggtgagatgattcgctttaaactcggt
ctaccggaagtggcggtcaacagctttagcctgtacgccagtgcagtgctggaagcgaac
ctgctgccaccaccagagccaaaacaggaatggcgcgatctgatgaacgtgttgtcggaa
gtctcatgcgaagcttatcgcgccgtggtgcgcggcgagccggatttcgtcccgtacttc
cgtcaggccacgccagaactggaactgggcaaattgccgctcggttcgcgcccggcaaaa
cgtaacccgaacgggggcgtagaaagcctgcgtgcgattccatggatcttctcctggagc
cagaaccgtctggtgctgccagcctggctgggtgccggtgaagcgattcaatattcgatc
gataagggtcatcaagcactgctggaagagatgtgtcgtgagtggccgttcttctcgacc
cgcctgggtatgctggagatggtgtacaccaaatgtaacatggacattgcgcgttattac
gatgagcgtctggtggatgaatcactgcgcccactcggtcagcgtctgcgcgatcaactg
caaaaagacattaagacggtgctcaacgtagagaacaatgagaacctgatgcagagcgat
ccgtggggccatgagtcaattcgtctgcgcaacatctacgtggagccattgaacatgctt
caggccgaactgttgtaccgtacgcgtcaatctcaggatgcggatccggaactggaagaa
gccttgatggtgacgattgcgggtatcgcagcaggtatgcgcaatactggctga

DBGET integrated database retrieval system