KEGG   Aliivibrio fischeri MJ11: VFMJ11_0930Help
Entry
VFMJ11_0930       CDS       T00754                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vfm  Aliivibrio fischeri MJ11
Pathway
vfm00250  Alanine, aspartate and glutamate metabolism
vfm00410  beta-Alanine metabolism
vfm00430  Taurine and hypotaurine metabolism
vfm00650  Butanoate metabolism
vfm01100  Metabolic pathways
vfm01110  Biosynthesis of secondary metabolites
vfm01120  Microbial metabolism in diverse environments
vfm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VFMJ11_0930
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VFMJ11_0930
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VFMJ11_0930
   00430 Taurine and hypotaurine metabolism
    VFMJ11_0930
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VFMJ11_0930
Enzymes [BR:vfm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VFMJ11_0930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DUF5446 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACH65184
UniProt: B5FCJ1
LinkDB All DBs
Position
I:complement(973320..974963)
Genome map
AA seq 547 aa AA seqDB search
MVTDNKTADASFESLLRIFTVPEAPDSTLGIIEKELSQNLNQFLREHIVAEEKPLTEIEK
DFTDSSMPESPTYVSEHTEHLLDTLVSQSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIFGQKDSFYQHWMHSADHSLGAFCSGGTIANITA
LWVARNRLLKPEGDFEGIAKQGLFAALTHYKCNGLAIFVSERGHYSLKKAADVLGIGQDG
VIAVKTDNNNRVCLDDLELKITQAKAKNIKPLAIVGVAGTTETGSIDPLRELANVAQREG
CHFHVDAAWGGATLMSNTYRHLLDGIDLADSVTIDAHKQLYVPMGAGMVIFKDPELMSSI
QHHAEYILRKGSKDLGRHTLEGSRSGMAMLLYSCFNVISRPGYELLINQSIEKAHYFADL
IQQQDDFELITDPELCLLTYRYVPSNVKAALAIATDEQKLEIYEHLDNLTKYIQKTQRET
GKSFVSRTRLTPEAYQHQPTIVFRVVLANPLTTKEILQNVLIEQREIASSSEISLPLLNQ
IVDKILH
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggtaacagacaacaaaacagcagatgcgagctttgaaagcctgctgcgaatttttact
gttccggaagctcccgattcgactcttggaataattgaaaaagaactttcacagaactta
aatcaatttttgagagagcatattgttgccgaagaaaagccattgacggaaatcgaaaaa
gattttaccgactcatcaatgcctgaatcgccaacctatgtatccgaacatactgagcac
ctgttagatacccttgtatctcaatccgttcatacctctgcaccaagctttattggccac
atgacatcggcattgccttactttttaatgccactttcaaaaatcatgattgccctaaac
caaaacttggtaaaaattgaaacatcaaaagcatttaccccgttagagcgtcaagtgctt
ggtatgctacaccgtctaattttcggtcaaaaagacagtttctatcaacactggatgcac
agcgctgatcattctctgggtgctttttgctcaggtggcaccattgctaatattacagcg
ttatgggttgcaagaaatcgcctattaaaaccagaaggtgattttgaaggcattgccaaa
caaggactttttgcagctcttacgcattataagtgcaatgggttagctattttcgtttca
gaacgtggtcactactcactcaaaaaagcagccgatgtattagggattggtcaagatggt
gttattgccgttaaaactgacaacaacaatcgtgtttgccttgatgatttagagcttaaa
attacccaagcaaaagcgaaaaacattaagccattggctattgttggggttgcaggaacc
acagaaacaggttcaattgacccactgcgtgagttagcaaatgttgctcaacgtgaagga
tgtcatttccatgtggatgccgcttggggcggtgcaacattaatgtcgaatacgtaccga
caccttttggatggtattgatttagccgattccgtaacgattgatgcacataaacaacta
tacgtaccaatgggtgcaggtatggttatctttaaagatcctgaattaatgtcttctatc
cagcatcatgctgagtacattcttcgtaaagggtctaaagatttaggtcgtcacacactt
gaaggttctcgaagtggtatggcgatgttgctttattcttgtttcaacgtgatcagtcgc
cctggttatgaattattaatcaaccaaagtattgaaaaagcacactactttgctgactta
attcaacagcaagatgattttgaactgataacagatcctgagctgtgtttgctgacttat
cgctatgttccaagtaatgtaaaagcggcactggccattgcaactgacgagcaaaagctt
gagatttatgaacacttggataatctcaccaagtacattcaaaaaacgcaacgtgaaact
gggaagtcttttgtttctcgaactcgattaacacctgaagcttatcagcatcaaccaacc
atcgttttcagagtcgtattagcaaatccattaacaacaaaagaaatactgcaaaatgtc
ttaattgagcaaagagaaattgcgagcagcagtgaaatatctttacctcttttaaaccaa
attgtagacaaaattcttcactaa

DBGET integrated database retrieval system