KEGG   Aliivibrio fischeri MJ11: VFMJ11_1137Help
Entry
VFMJ11_1137       CDS       T00754                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vfm  Aliivibrio fischeri MJ11
Pathway
vfm00250  Alanine, aspartate and glutamate metabolism
vfm00410  beta-Alanine metabolism
vfm00430  Taurine and hypotaurine metabolism
vfm00650  Butanoate metabolism
vfm01100  Metabolic pathways
vfm01110  Biosynthesis of secondary metabolites
vfm01120  Microbial metabolism in diverse environments
vfm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VFMJ11_1137
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VFMJ11_1137
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VFMJ11_1137
   00430 Taurine and hypotaurine metabolism
    VFMJ11_1137
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VFMJ11_1137
Enzymes [BR:vfm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VFMJ11_1137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ACH65664
UniProt: B5FDE3
LinkDB All DBs
Position
I:1200567..1201961
Genome map
AA seq 464 aa AA seqDB search
MPLHSKNAVRDDLLDDIYSSADLSLSMPKYKMPEQEHDPRHAYQVIHDELMMDGNSRQNL
ATFCQTWVEDEVHKLMDECIDKNMIDKDEYPQTAELESRCVHMLADLWNSPDAENTLGCS
TTGSSEAAMLGGMALKWAWREKMKKLGKPTDKPNMICGPVQVCWHKFARYWDIELREIPM
EGDRLIMTPEEVIKRCDENTIGVVPTLGVTFTCQYEPVKAVHEALDKLQEETGLDIPMHI
DAASGGFLAPFCDPDLEWDFRLPRVKSINASGHKFGLSPLGVGWVIWRDASALHEDLIFN
VNYLGGNMPTFALNFSRPGGQIVAQYYNFLRLGKEGYRKIHQACYDTAVYLSSEIEKLGM
FEIIYDGKGGIPAMSWSLKEGVDPGFNLFDLSDRIRSRGWQIAAYAMPPKREDLVIMRIL
VRHGFSRDQADLLVADLKHCVEFFAKHPISHGSDELESSGFNHG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttcattccaaaaacgcagtcagagatgatcttcttgatgatatttattcatca
gctgacctttcgttatccatgccaaaatataaaatgcctgaacaagaacatgacccacgt
catgcctaccaagtcattcatgatgagctcatgatggatggtaattctcgacagaactta
gcaacgttttgccaaacttgggttgaagatgaagtccataaattaatggatgaatgtatc
gataaaaatatgatcgataaagatgaataccctcaaactgctgaattagaatctcgctgt
gtgcatatgctagcggatttatggaactctcctgacgcagaaaacacactaggttgttca
actacaggttcaagtgaagccgctatgctaggtggtatggcattaaaatgggcttggcga
gaaaaaatgaaaaaacttggcaaaccaacagataagccaaatatgatctgtggtcccgtt
caagtatgttggcataaatttgcacgctattgggatattgaattacgtgagatcccaatg
gaaggcgatcgcttgatcatgacgcctgaagaagtgattaaacgttgtgatgaaaatacc
attggtgttgttccaacactgggggtgacttttacttgtcaatatgagcctgtgaaagcg
gtacatgaagcgctagataagttacaagaagagacgggtttagatattccaatgcacatt
gatgcggcgagtggtggtttcttagctccgttctgtgatcctgatttagagtgggacttc
cgtcttcctcgagttaaatcgattaatgcatcaggtcataaatttggcctaagcccacta
ggtgtgggttgggtaatttggcgtgacgcatcagccttgcatgaagatttgatttttaat
gtgaactatttaggtggcaatatgccgacctttgcattgaacttctctcgcccaggtggc
caaattgtagcgcaatactacaatttcctacgtttaggaaaagaagggtatcgtaagatc
caccaagcgtgttatgacactgctgtttatttatcatctgaaattgaaaaactgggtatg
tttgaaattatctatgatggtaaaggtggtattccagcaatgagttggtcattgaaggaa
ggcgttgatcctggttttaatttgtttgacctatcggatcgaattcgttctcgtggttgg
caaattgcggcttatgcaatgccaccaaaacgtgaagatttagttatcatgcgtatttta
gtacgtcatggattcagtcgagatcaagctgatttattggttgcggacttaaaacattgc
gttgagttttttgctaagcatcctatttctcatggtagtgatgagttggaatcatcagga
tttaaccacggctaa

DBGET integrated database retrieval system