KEGG   Aliivibrio fischeri MJ11: VFMJ11_1709Help
Entry
VFMJ11_1709       CDS       T00754                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
vfm  Aliivibrio fischeri MJ11
Pathway
vfm00240  Pyrimidine metabolism
vfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vfm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    VFMJ11_1709 (tdk)
Enzymes [BR:vfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     VFMJ11_1709 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ACH65290
UniProt: B5FF28
LinkDB All DBs
Position
I:complement(1813670..1814248)
Genome map
AA seq 192 aa AA seqDB search
MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMNPAIFTAAIDDRYGVGKVSSRIGLHAEAH
LFNKETNVFDAIKELHEAEKLHCVLIDECQFLTKEQVYQLTEVVDKLNIPALCYGLRTDF
LGELFEGSKYLLSWADKLVELKTICHCGRKANMVIRTDEHGVAIADGDQVAIGGNELYVS
VCRRHYKEALGK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaaatgtatttttattactctgcaatgaatgcggggaaatcaacaacacttctt
caatcatcatttaactatcaagaacgcggtatgaatcctgctatttttacagcagcgatt
gatgatcgttatggtgttggtaaagtaagttctcgaattggtttacatgcagaagcacac
ttgtttaataaagaaacgaatgtattcgatgcaattaaagagttgcatgaagcagaaaaa
cttcactgtgttttaattgatgaatgtcagtttttaacgaaagaacaagtatatcaactg
acagaagtcgttgataaattaaacatcccagcactttgttatggcttacgaactgacttt
ttaggagagttatttgagggaagtaaatatttactttcttgggctgataaattggttgaa
ttaaaaaccatttgtcactgtggacgtaaagcaaacatggtgatccgtacggatgagcat
ggtgtagctattgcggatggtgatcaagttgctatcggtggtaatgagctgtacgtttca
gtatgtcgacgtcattataaagaagcgctaggtaaatag

DBGET integrated database retrieval system