KEGG   Aliivibrio fischeri MJ11: VFMJ11_A0584Help
Entry
VFMJ11_A0584      CDS       T00754                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vfm  Aliivibrio fischeri MJ11
Pathway
vfm00473  D-Alanine metabolism
vfm00550  Peptidoglycan biosynthesis
vfm01100  Metabolic pathways
vfm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vfm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VFMJ11_A0584
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VFMJ11_A0584
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    VFMJ11_A0584
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vfm01011]
    VFMJ11_A0584
Enzymes [BR:vfm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VFMJ11_A0584
Peptidoglycan biosynthesis and degradation proteins [BR:vfm01011]
 Precursor biosynthesis
  Amino acid ligase
   VFMJ11_A0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 Ribosomal_L7Ae
Motif
Other DBs
NCBI-ProteinID: ACH63474
UniProt: B5ETW5
LinkDB All DBs
Position
II:676226..677218
Genome map
AA seq 330 aa AA seqDB search
MTHILLLCGGGGTEHEVSLVSSKYIAQQLSELDAFDITHLEIKDEGWFHIESGLKYELRS
DKTLLSGETVSSPVDYVVPCIHGYPGETGDIQSMLDMLSIPYLGCDAESSTNSFNKITSK
LWYDALGIPNTPYLFLTENNEETHQSALAAFKQWGGLFVKAACQGSSVGCYKVTSEEELA
QAINGAFGYSQQVLVEKAVKPRELEVAAYEIDGQLFTTAPGEVTAPDGAFYTYDEKYGSG
SHSTTSLDAQNLTEEQVKLIDQYSRKVFTQMKLKDLSRIDFFLTDDNEIYLNEVNTFPGM
TPISMFPKLLEHNGDCFKTFLQKAVLNAIK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgactcatatccttttactttgtggcggtggcggcactgaacacgaagtttcattagtt
tcttcaaaatatatcgctcaacaactttctgaacttgatgcctttgatatcacgcatctt
gagattaaagatgaaggttggtttcatattgaatctggcttgaagtacgaattacgttca
gacaaaacattattaagcggtgagacagttagctctccagtggattacgttgttccgtgt
attcatggttaccctggtgaaaccggcgatattcaatctatgttagatatgcttagcatt
ccgtatttaggatgtgatgcagaatcaagtacaaatagcttcaataagatcacatctaag
ctttggtatgatgcgcttggtatcccaaatacaccgtacttattcttaactgaaaataat
gaagaaacccatcagtcagcattagctgcatttaagcaatggggcgggctatttgtaaaa
gcggcatgtcagggttcatcggttggttgttacaaggtaacttctgaggaagagctagcg
caagcaattaatggtgccttcggttattcacaacaagtgttggttgaaaaagcggtaaaa
cctcgtgaacttgaagttgcagcatacgaaattgatgggcaattatttacgacggctcca
ggtgaagtaacggcacctgatggtgctttttatacatatgacgaaaaatacggcagcggt
agccattcaacgacatctttagatgcacagaatcttacagaagaacaagttaagctgatc
gatcaatacagccgtaaagtattcactcaaatgaaacttaaagacctttctcgtattgat
ttcttcctaacggatgataatgaaatttacttaaatgaagtgaatacgttcccaggaatg
acgccaatttcaatgttccctaagttgttagaacataatggcgattgcttcaaaactttc
ttgcaaaaagcagtgcttaacgcaattaagtaa

DBGET integrated database retrieval system