KEGG   Vibrio furnissii: vfu_A00358Help
Entry
vfu_A00358        CDS       T01680                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vfu  Vibrio furnissii
Pathway
vfu00071  Fatty acid degradation
vfu00280  Valine, leucine and isoleucine degradation
vfu00281  Geraniol degradation
vfu00310  Lysine degradation
vfu00362  Benzoate degradation
vfu00380  Tryptophan metabolism
vfu00410  beta-Alanine metabolism
vfu00640  Propanoate metabolism
vfu00650  Butanoate metabolism
vfu00903  Limonene and pinene degradation
vfu00930  Caprolactam degradation
vfu01100  Metabolic pathways
vfu01110  Biosynthesis of secondary metabolites
vfu01120  Microbial metabolism in diverse environments
vfu01130  Biosynthesis of antibiotics
vfu01200  Carbon metabolism
vfu01212  Fatty acid metabolism
Module
vfu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    vfu_A00358
   00650 Butanoate metabolism
    vfu_A00358
  09103 Lipid metabolism
   00071 Fatty acid degradation
    vfu_A00358
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    vfu_A00358
   00310 Lysine degradation
    vfu_A00358
   00380 Tryptophan metabolism
    vfu_A00358
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    vfu_A00358
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    vfu_A00358
   00281 Geraniol degradation
    vfu_A00358
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    vfu_A00358
   00930 Caprolactam degradation
    vfu_A00358
Enzymes [BR:vfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     vfu_A00358
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     vfu_A00358
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     vfu_A00358
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     vfu_A00358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ADT85583
UniProt: F0LQI9
LinkDB All DBs
Position
1:complement(381768..383939)
Genome map
AA seq 723 aa AA seqDB search
MIYQAKTLQVKELHDGIAELSFCSPESVNKLDLATLQSLDEALDALSAHAGLTGVVLTSN
KDAFIVGADITEFLGLFAKPESELDDWLIFANRIFNKLEDLPVPTLSALKGFTLGGGCEC
VLATDFRIGDQTTSIGLPETKLGIMPGFGGTVRLPRLVGADSAMEIITQGKACRAEEALK
IGLLDALVDSDKLLESALATLTQAINEKVDWQMRRQQKTSPLTLSKLEAMMSFTMAKGMV
AQLAGPHYPAPMTSVVTIEEAARCARDEALAIERKHFIKLAKSQEAQALVGIFLNDQYIK
GLAKKSAKAASKATERAAVLGAGIMGGGIAYQSASKGVPVLMKDIAQTSLDLGMTEASKL
LNKQLARGKIDGFKMAGVLASITPSLHYAGIEQADVIVEAVVENPKVKAAVLSEVEQNVS
AETIITSNTSTIPINLLAKSLQRPENFCGMHFFNPVHRMPLVEIIRGEHTSEDTINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSLLMRDGADFTQVDKVMERQFGWPMGPAY
LLDVVGIDTAHHAQEVMAQGFPQRMGKQGRDAIDALYEANKYGQKNGSGFYQYTIDKKGK
PKKAFSSDILPVLETVCGAKAAFDAQTIIARMMIPMINEVALCLEEGIIATAQEADMALV
YGLGFPPFRGGVFRYLDSIGLANYVAMAKQYEHLGAMYQVPQLLIDKAAKGESFYQSQQA
SSL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccaaaaccctacaggtaaaggaattacatgatggtattgcggagtta
agtttctgctcacccgaatccgtcaataagcttgacctcgccaccctgcaatcgcttgat
gaagcgctggatgccctgagtgcgcatgccggactaaccggggttgtgttaacttcaaac
aaagacgccttcatcgtcggtgccgacatcaccgaatttctcggcttatttgccaagcca
gaatccgagctcgatgactggttgatctttgccaaccgcattttcaataagctggaagat
ttgcccgttcccaccttatccgcactgaaaggcttcacgctcggcggtggatgtgagtgt
gtactcgcgaccgacttccgcatcggtgatcaaaccaccagcattggattgccagaaacc
aaactcggcatcatgcctggctttggtggcacggttcgtttgccacgccttgtgggcgca
gacagcgcgatggaaatcatcacacaaggaaaagcctgccgcgcagaagaagccttaaaa
atcggtttgctagacgcgttggtcgacagcgacaaactactggaatcggcgctggcgacg
ttaacacaagccatcaatgaaaaagtcgactggcaaatgcgtcgtcagcaaaaaacatcg
ccgctgacgctcagcaagctcgaagcgatgatgagcttcaccatggccaaaggcatggtc
gcgcaattggcaggcccacattacccggcgccaatgacttctgtcgtaacgattgaagaa
gccgctcgctgcgcgcgcgatgaagcgctggcgatcgaacgcaaacatttcatcaagctg
gcgaaatctcaggaagcacaagcgttggtcggtattttcctcaacgatcaatacatcaaa
ggcctggcgaaaaaatccgccaaagcagccagcaaagccacagagcgtgcagcggtactg
ggtgccggcatcatgggtggcggcattgcttaccagtctgccagcaaaggcgtgccggta
ctgatgaaagatatcgcgcagacatcactagatttaggcatgaccgaagcatccaagctg
ctgaataaacagctggcacgcggcaaaattgatggttttaaaatggctggcgttctggct
tccatcacgccaagcctgcattacgcaggtatcgaacaagccgatgtgatcgtcgaagca
gtggtggaaaatccaaaagttaaagctgcggtattgagcgaagtggaacaaaacgtctct
gctgagaccatcattacgtccaacacctcaaccattccaattaatctgctggccaaatcg
ctgcagcgcccggaaaacttctgtggcatgcatttcttcaacccggtacatcgcatgccg
ctggttgaaatcattcgcggcgagcacacctctgaagacaccattaaccgcgttgtggct
tacgccgccaagatgggtaaatcgccgattgtggtcaatgactgtccgggattcttcgtc
aaccgcgtgctgttcccctactttggcggctttagcctgctgatgcgtgacggtgcggac
ttcactcaggttgataaagtgatggaacgtcagttcggctggcccatgggtccggcgtac
ctgctggatgtagtcggtatcgataccgcgcatcacgcgcaggaagtgatggcgcaaggt
ttcccgcaacgtatgggtaaacaaggccgtgacgcgattgatgccctgtatgaagcgaac
aaatatggtcagaagaacggttcaggcttctatcagtacacaattgataaaaaaggcaaa
ccgaaaaaagcgttctcaagcgatattctgcccgtgctggaaaccgtgtgtggtgcaaaa
gcggcgtttgacgcacaaaccattatagctcgaatgatgattccgatgatcaacgaagtc
gccctgtgtctggaagaaggcattatcgccacagcacaagaagcggatatggcgttggtc
tacggcctcggtttccctcctttccgcggcggcgtgttccgttacctcgacagcattggc
ctggctaattatgtcgcgatggcgaaacagtatgaacacttgggcgccatgtaccaagtc
ccacaactgctgatcgacaaagcggcaaaaggcgaaagcttttaccagtcacagcaagcc
agctcgctataa

DBGET integrated database retrieval system