KEGG   Vibrio furnissii: vfu_A00618Help
Entry
vfu_A00618        CDS       T01680                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vfu  Vibrio furnissii
Pathway
vfu00620  Pyruvate metabolism
vfu00680  Methane metabolism
vfu01100  Metabolic pathways
vfu01120  Microbial metabolism in diverse environments
vfu01200  Carbon metabolism
Module
vfu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vfu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    vfu_A00618
  Energy metabolism
   00680 Methane metabolism
    vfu_A00618
Enzymes [BR:vfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     vfu_A00618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF29 HAMP
Motif
Other DBs
NCBI-ProteinID: ADT85825
UniProt: F0LRW9
LinkDB All DBs
Position
1:complement(639528..642161)
Genome map
AA seq 877 aa AA seqDB search
MNEKYAALKSNVSMLGRLLGQTIQDADGDVILEKVETIRKLSKSARAGNQADHANLIEEI
KSLNNDELTPVARAFNQFLNLTNIADQYHTISRHCEAHVCEPDAVHSLFSQLSQNGISKL
DTAQAVRDLNIELVLTAHPTEITRRTMINNLVKINECLSKLELSELSSKERLKTERRLEQ
LIAQGWHSDVIRKQRPTPLDEAKWGFAVVENSLWQAVPEFLRELNESVKGYLGEGLPIDA
RPVHFSSWMGGDRDGNPFVTHSITREVMLLSRWKAADLYLGDISELVAELSMTKCNDTLR
ELAGEEEHEPYRAVLKRVRSLLQETLDILDAKIHGQKLAVKAPLQNISQLWDPLYACYQS
LHECGMGVIADGSLLDTLRRVKAFGVHLVRLDIRQESTRHSDVLSELTRYLGIGDYNHWS
EQDKIAFLTNELASKRPLLPRDWEPSEPVKEVLDTCKIIAAQPREAFGAYVISMARTASD
VLAVHLLLQESGCPYRMDVCPLFETLDDLNNAEAVITQLMSIDLYRGFIQNHQMVMIGYS
DSAKDAGVMAAGWAQYHAMESLVRVAEEAGVELTLFHGRGGTIGRGGAPAHAALLSQPPK
SLKGGLRVTEQGEMIRFKLGLPEVAVNSFNLYASAVLQANLLPPPEPKQEWRDLMNVLSE
VSCEAYRAVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPNGGVESLRAIPWIFSWS
QNRLVLPAWLGAGEAIQYSIDKGHQALLEEMCREWPFFSTRLGMLEMVYTKCSVDIARYY
DERLVDEALRPLGQRLRAQLQKDIKTVLNVENNENLMQSDPWGHESIRLRNIYVEPLNML
QAELLYRTRQSQEPAPELEEALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaatacgccgcgctcaaaagtaacgtgagcatgttgggtcgactcctcggt
cagaccattcaagatgcagacggagacgttattttagagaaagtggagaccatccgaaaa
ctttccaaatctgcccgcgccggcaaccaagcggatcacgcgaatctcattgaagagatt
aaaagccttaacaacgatgagctcacgcccgtcgctcgtgctttcaaccaattcttgaac
ctgaccaacatcgccgatcaataccacaccatttcacgtcattgtgaagcgcatgtgtgt
gaaccggatgcggtgcattcgctgttcagccaactgagccagaacggcatcagcaaactg
gataccgcccaagcggtacgcgatctgaacattgaactggtgctgaccgcgcacccgacg
gaaatcacccgtcgcaccatgatcaacaacctggtcaaaattaacgaatgcctgtccaaa
ctggagctgagcgaactctcttccaaagaacgcctcaaaaccgagcgtcgcttagagcag
ttgatcgcacagggctggcattccgacgtgattcgtaaacagcgcccaaccccgctggat
gaagccaaatggggctttgccgtggtggaaaactctctgtggcaagcggtacctgagttt
cttcgtgaactaaacgagagcgtcaaagggtatctgggagaaggattacctatcgacgct
cgtccggtacacttctcctcttggatgggcggcgaccgcgacggtaacccgttcgtgacc
cactccatcacgcgtgaagtgatgctgctgtcgcgctggaaagctgccgacctgtattta
ggcgacatcagcgagttggtggccgaactgtcgatgaccaaatgcaacgacacgctgcgt
gaactggccggtgaagaagagcacgaaccgtatcgcgcggtgttgaaacgcgttcgttcg
ttgctgcaagaaacactcgatattctcgatgcaaaaattcacggccaaaaactcgctgtg
aaagcaccgctgcaaaacatcagccagctgtgggatccactgtacgcctgttaccaatcg
ctacatgagtgtggcatgggcgtgattgccgacggctcgctgctcgataccctgcgccgc
gtcaaagcgttcggggtccacttggtacgcctcgacattcgccaagaaagcacccgtcat
tccgatgttttgtcggaactgacccgttaccttggcatcggtgattacaatcactggagc
gaacaagacaaaattgcgttcctgaccaacgagctggcgtccaaacgtccgctgttgcca
cgcgattgggaaccgtctgagccggtcaaagaagttctggatacctgtaagatcatcgcc
gcgcagccgcgcgaagcgtttggtgcttacgtgatttcaatggcgcgcaccgcttcagat
gtgctcgcggttcacctgctgctgcaagaatcgggctgcccttaccgcatggacgtgtgt
ccactgtttgaaacgctggacgacctcaacaacgccgaagccgttattactcaattgatg
agcatcgatctctaccgcggctttattcaaaaccatcaaatggtcatgatcggttactcc
gattccgccaaagatgctggtgtgatggccgcaggttgggcgcagtaccacgcgatggaa
tcgctggtgagagtggcagaagaagcgggtgttgaactgactctgttccacggccgtggc
ggtacaattggtcgtggtggcgcgccagcgcacgcggcactgctgtctcagccaccgaaa
agcttgaaaggcggcctgcgcgtgacggagcaaggcgagatgattcgctttaaactcggt
ctgcccgaagtcgcggtcaacagctttaacctatacgccagcgcggtgttgcaagcgaac
ctgctgccaccaccggagccaaaacaggaatggcgcgatctgatgaacgtgctgtcggaa
gtgtcatgtgaagcctatcgtgccgtggtacggggcgaaccggactttgtgccgtacttc
cgccaagccacgccggagctagaactgggtaaactgccgctgggctcacgtccggccaaa
cgtaacccgaacggcggcgtcgaaagcctgcgtgcgatcccgtggatcttctcgtggagc
caaaaccgtctggtcttgcctgcgtggctgggagcgggtgaagcgattcagtactctatc
gacaaaggccatcaggcactgttggaagagatgtgccgcgaatggccgttcttctctacc
cgtctgggcatgctggaaatggtgtacaccaagtgcagcgtcgacattgcccgttactac
gacgagcgtttggtggatgaagcactgcgcccactgggccaacgcctgcgcgcgcaactg
caaaaagacatcaagaccgtgctgaacgtcgagaacaacgaaaacttgatgcaaagtgat
ccgtggggccatgagtccattcgtctgcgcaacatctacgtcgaaccgttgaacatgctg
caggccgaactgctgtaccggacgcgtcaatcgcaggaaccagcaccagaactggaagaa
gcgctgatggtcaccattgcgggcattgcagcaggtatgcgcaataccggctaa

DBGET integrated database retrieval system