KEGG   Vibrio furnissii: vfu_A01274
Entry
vfu_A01274        CDS       T01680                                 

Definition
(GenBank) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vfu  Vibrio furnissii
Brite
Enzymes [BR:vfu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     vfu_A01274
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-ProteinID: ADT86459
LinkDB
Position
1:complement(1324490..1325074)
AA seq 194 aa
MAFELPALPYAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLSPNGGGEPTGAVADAINAAFGSFEEFKAKFTDSAINNFG
SSWTWLVKKADGSLAITNTSNAATPLTEEGVTPLLTVDLWEHAYYIDYRNVRPDYMNGFW
ALVNWEFVAANLAK
NT seq 585 nt   +upstreamnt  +downstreamnt
atggcatttgaattaccagctcttccttacgctaaagacgcactggaaccacacatctct
gcagagactctggattaccaccacggtaagcaccacaacacttacgttgttaagctgaac
ggtctgatcccaggtactgagtttgaaggtaaaactctggaagagatcatcaagacttca
actggcggtgtattcaacaacgcagcgcaaatctggaaccacacgttctactggcactgt
ctgtctccaaatggcggcggcgaaccaactggcgcagtagcggatgcaatcaacgcagca
ttcggttctttcgaagagttcaaagctaaattcactgattcagcaatcaacaacttcggt
tcatcttggacttggcttgtgaagaaagcagatggctctttggctatcacgaacacttct
aacgccgcgacgcctctgactgaagaaggcgtaacaccactgctgactgttgacctgtgg
gaacacgcgtactacatcgattaccgtaacgtacgtccagattacatgaacggtttctgg
gctctggttaactgggaattcgttgcagcgaacctagctaaataa

DBGET integrated database retrieval system