KEGG   Vibrio furnissii: vfu_A02306Help
Entry
vfu_A02306        CDS       T01680                                 

Definition
(GenBank) glutamate decarboxylase, hypothetical
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vfu  Vibrio furnissii
Pathway
vfu00250  Alanine, aspartate and glutamate metabolism
vfu00410  beta-Alanine metabolism
vfu00430  Taurine and hypotaurine metabolism
vfu00650  Butanoate metabolism
vfu01100  Metabolic pathways
vfu01110  Biosynthesis of secondary metabolites
vfu01120  Microbial metabolism in diverse environments
vfu02024  Quorum sensing
Module
vfu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    vfu_A02306
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    vfu_A02306
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    vfu_A02306
   00430 Taurine and hypotaurine metabolism
    vfu_A02306
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    vfu_A02306
Enzymes [BR:vfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     vfu_A02306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 DUF5446
Motif
Other DBs
NCBI-ProteinID: ADT87440
UniProt: F0LQA4
LinkDB All DBs
Position
1:2397608..2399251
Genome map
AA seq 547 aa AA seqDB search
MVSEHKTADANFDTLLRIFTVPEGPDSTLTRIEEELSRNLNKFLREHIVAEEKPLKEIEK
DFSDARIPDEPEFVSDHTQHLLDTLVAQSVHTASPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYGQDDAFYQQWMHSAEHSLGAFCSGGTIANITA
LWVARNNALKADGDFHGVEKEGLFKAMRHYGYDGLAILVSERGHYSLKKAADVLGIGQEG
LVSVKTDENNRICPDDLQRKITELKANNIKPFAVVGVAGTTETGNVDPLRVMAEISHQEG
CHFHVDAAWGGATLMSNHHRHVLDGVELADSVTIDAHKQLYIPMGAGMVLFKDPSAMNSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYASMHIISRAGYELLIDQSIAKARYFADL
IEAQDDFELVSQPELCLLTYRYLPQNARQALQQASADEQALLNELLNELTKFIQKKQRET
GKSFVSRTRLNPMVWNKLDTLVFRVVLANPLTTHDILQSVLDEQRQIATLAPNLMGRIEH
LAQQILA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggtatctgaacacaaaaccgcggatgcgaactttgacactctgcttcgtatattcacc
gtacccgaagggccagactcaacactgacccgaatcgaagaagagctctctcgcaacctg
aataagtttctgcgcgaacacatcgtggcagaagagaagccattgaaagagatcgaaaaa
gatttctccgatgcccgcattcctgatgagccggaatttgtttctgaccatacgcaacat
ctgctcgacaccttagtcgcccaatcagtgcataccgcatcccccagttttatcggccac
atgacctcagcgctgccctattttttgatgccgctgtcaaaaatcatgatcgccctgaat
caaaacttggtcaaaatcgaaacgtcaaaagcatttacgccgctagaacgtcaagtgctg
ggaatgctgcaccgcttgatctacgggcaggatgacgccttctatcaacaatggatgcac
agcgcagagcactcattgggtgcattctgctctggaggaaccattgccaacattacggcc
ttgtgggttgcccgtaacaacgcattgaaagccgacggtgattttcatggcgtggagaaa
gaaggtctgttcaaagccatgcgccactacggttatgacggtttggcgattctggtttct
gaacgcggccactactcgctgaagaaagccgctgatgttctgggcattggtcaagaaggc
ttggtttcggtcaaaaccgatgagaacaaccgcatctgtccagatgatcttcaacgcaaa
attaccgaactcaaagccaacaacatcaaaccatttgcagtcgttggtgtggcgggcacc
acggaaacaggcaacgttgacccgctgcgggtaatggcggaaatctcacatcaagaaggc
tgccatttccatgtcgatgccgcttggggcggtgcaaccttgatgtcgaatcaccatcgc
catgtgttagatggcgtcgagcttgccgattcagtcaccattgatgcccacaaacagctc
tacattccaatgggcgcaggcatggtgctgtttaaagacccaagtgccatgaattcgatt
gagcaccatgcgcagtacattttacgcaaaggctcaaaagatctaggtagccatacgtta
gaaggctcccgctccggcatggccatgttagtctatgccagcatgcacatcatcagtcgc
gccggttacgaactgctcatcgaccaaagcattgccaaagcgcgttactttgccgatctg
atagaagcgcaagatgacttcgagttggtctctcaaccggagttatgcttgctcacgtac
cgttatttgccgcaaaatgctcgccaagcgctgcaacaagccagtgccgacgagcaagca
ctactcaatgaattattgaatgaactgaccaagtttattcagaagaaacaacgggaaacc
ggtaaatcgtttgtttcacggacacggctcaacccgatggtttggaacaaattggatacc
ctcgtttttcgcgtcgttctggcgaacccgctaacaacccatgatatccttcaatcggtg
ctggacgagcaacgccaaattgccacgttagccccgaatttgatgggcagaattgaacat
ttagcacaacaaatactggcataa

DBGET integrated database retrieval system