KEGG   Vibrio furnissii: vfu_B01419Help
Entry
vfu_B01419        CDS       T01680                                 

Definition
(GenBank) Alkyl hydroperoxide reductase, large subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vfu  Vibrio furnissii
Brite
KEGG Orthology (KO) [BR:vfu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    vfu_B01419
Enzymes [BR:vfu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     vfu_B01419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 Thioredoxin_3 FAD_oxidored GIDA FAD_binding_2 HI0933_like Glutaredoxin DAO FAD_binding_3 Thioredoxin_9 NAD_binding_8 AlaDh_PNT_C Thi4 DUF5474
Motif
Other DBs
NCBI-ProteinID: ADT89597
LinkDB All DBs
Position
2:complement(1502411..1503979)
Genome map
AA seq 522 aa AA seqDB search
MLDQAIKQQLQQYLTNLKEDVRLVVSLDESKGSQDILALANEIAELSPLITVERDDAASD
RKPVMTVQNPNKGTQLRFAGVPMGHEFTSLVLALLHSGGHPIKLEQETIEQIAKLGKKLD
VEVFISLSCQNCPDVVQAFNMMAAINPDIRATMIDGALFQDEVKNRDIMAVPSVFINGEL
FGQGRMTLTEILNKLDDGAAEKAAASLNEKDPYDVLVVGGGPAGAAAAIYAARKGIRTGI
VAQRLGGQVMDTMAIENFISVKHTEGPKLAANLGEHLKEYGVDIITEQQAEKLMGAEFTA
DGKIHVNLQSGATLKSNSVILSPGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADVLRADQVLINKANSMPNIDIITMAQTTEVVG
DGTRVTGLKYKDRNTDEIKQIDLSGIFVQIGLVPNTEWLKDSAVELSARGEIEIGSRGET
SMDGVFAAGDATTVPYKQIIIAMGEGAKASLGAFDYLIRKQS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctagaccaagcgatcaagcaacagttacaacagtatctgaccaatttaaaagaagac
gtccgtttagtggtcagcctagatgaaagcaaaggctcacaagacattttggcattggcg
aatgaaatcgctgaactcagcccactgatcaccgttgagcgtgatgatgcggcaagcgat
cgcaagcctgtcatgacggtccaaaatccaaataaaggcacacaactgcgttttgcaggc
gtacccatgggccacgaatttacatctctggttttggcgttgctgcactcaggcggccac
cccatcaaactagagcaagaaaccattgagcaaatcgcaaaactcggcaaaaagctcgat
gttgaagtgttcatttctctgtcttgccaaaactgtcctgacgtcgtgcaagcgttcaac
atgatggcagcgatcaacccagacattcgcgccaccatgatcgacggcgcgctgttccaa
gatgaagtgaaaaaccgcgacatcatggctgttccaagtgtgttcattaacggtgaactg
tttggtcaaggccgcatgaccctgactgaaatcctgaacaaactcgatgatggcgccgca
gaaaaagcagcagccagcctgaacgaaaaagacccatacgatgtactcgtggtcggcggt
ggccctgcaggtgcagcggcagccatttacgcagcgcgtaaaggcattcgcaccggtatc
gtggcgcagcgtttgggtggtcaggtgatggacaccatggcgatcgaaaacttcatctcg
gtgaaacacacagaaggtccaaaactggcggcgaacttgggtgaacacctgaaagagtac
ggcgtagacatcatcacagagcaacaagctgaaaaactgatgggcgctgaattcaccgca
gatggcaaaattcatgtgaacctgcaaagcggcgcgacactgaaaagtaacagcgtcatc
ttaagcccgggtgcgcgctggcgtgaaatgaacgtgcctggcgaacaagaataccgcaac
aaaggcgtggcgtactgcccgcactgtgacggcccattgttcaaaggcaagaaaaccgca
gtgatcgggggtggtaactcaggcatcgaagcggcgattgacttagcgggtatcgttgag
cacgtaaccgtactggaatttgctgatgttctgcgcgcagaccaagtgctgatcaacaaa
gcgaattcaatgccaaacatcgacatcatcacgatggctcaaaccaccgaagtggtgggt
gatgggactcgtgtgacgggtttgaaatacaaagaccgcaacaccgatgaaatcaagcag
attgacctgtctggtatcttcgtccaaatcggtctggtgcctaacaccgaatggctgaaa
gattcagcggttgaactgtctgctcgtggcgagattgaaatcggcagccgcggcgaaacg
agcatggatggtgtgtttgctgcaggtgacgcaacgaccgtcccttacaaacagatcatc
attgcgatgggtgaaggtgcgaaagcgagcttaggcgcgtttgactacctcatccgcaaa
caaagttaa

DBGET integrated database retrieval system