KEGG   Viruses: 11464107
Entry
11464107          CDS       T40000                                 

Gene name
UL33, AoHV-1_gp036
Definition
(RefSeq) Aotine betaherpesvirus 1; envelope glycoprotein UL33
  KO
K22782  Cytomegalovirus G-protein coupled receptor UL33
Taxonomy
TAX:50290
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Aotine betaherpesvirus 1)
SSDB
Motif
Pfam: 7tm_1 Peptidase_M48_N
Other DBs
NCBI-GeneID: 11464107
NCBI-ProteinID: YP_004940059
RS: NC_016447
UniProt: G8XUA8
LinkDB
Position
NC_016447:join(39658..39693,39774..41057)
AA seq 439 aa
MEVVLEIINNTAVYQQSYLHINDSCNATTSLMTARSIEGLVNTVIILVGAPLNCIVLLTQ
MLSNRVYGYSTPALYMTNLSSANLVTLMVLPFIVLGNRGYMTGSIVTCKFFALAYYSSCT
VGFATVALIAADRYRVLHRKTHARSSYTRTYVILGSTWIISLMCATPVALYTTLIIHDNR
FGIGQFTCVVFFQYGQIRTVLAGLKSMIILLWGITPVTMMTWFYAFFYKTLKKVSNQKRH
RTITFISLLLLSCLIIQTPYVMIMLFDITALMTWPTEDCQLLNRRKAINTLTKLVPNFHC
LINPILYAFLGNNFLEKLKQCFRGQLFDRRAFLRSRQNSMAKQQNNTSSRRPSVSPLVSD
PAVSTLRSPNREGNTSPTGTFPKKTAPQSPDEESVRTLPRSNPSKTPSVSWVPPIPPPKP
SQKLPRQALAPQGLPGRPQ
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggaagtggtgctggagattatcaacaacaccgcggtgtatcagcaatcctacctgcac
atcaatgactcctgcaacgccaccacctcgctgatgacggccagatccatcgagggcttg
gtgaacaccgttatcatcctcgtcggggcccccctcaactgcatcgtcctgctcacgcag
atgctgtccaaccgggtctatggctactccacgcccgcgctctacatgaccaacctctcc
tcggccaacctggtcacgctcatggtactacccttcatcgtcctgggcaaccgcggttac
atgacaggaagcatcgtcacctgcaagtttttcgccctcgcctactattccagctgcacg
gtgggcttcgccaccgtggccctcatcgccgcggaccgctaccgcgtcctccaccgaaag
acgcacgcgcggtcctcgtacaccagaacgtacgttattctgggcagcacctggatcatc
tcgctgatgtgcgcgaccccggtggcgctgtacaccaccctgattatccacgataaccgc
ttcggcatcggccagtttacctgcgtggtgtttttccaatacggccagatccgcacggtg
ctggcgggcctcaagagcatgatcatcctgctttggggcatcacccctgtcaccatgatg
acctggttctacgcttttttctataagacgctcaaaaaggtctccaaccagaagcgacac
cgcaccatcaccttcatcagcctgctactcctgtcgtgcctcattatccaaaccccgtac
gtgatgatcatgctcttcgacatcaccgccctcatgacctggcccacggaagattgccaa
ctcctcaaccgcagaaaggccatcaacaccctcaccaagctggtgcccaactttcactgc
ctcatcaaccccatcctgtacgcgttcctcggcaacaatttcctggagaagctcaagcag
tgcttccgaggacaactgtttgaccgtcgcgccttcctgcgatcccggcagaattccatg
gccaaacagcagaataacacctccagccgcagaccgtccgtctcgccgctggtgtcggac
cctgcggtctccaccctccgatcgccaaaccgcgaaggaaacacgtcaccgaccggcacc
ttccccaaaaagaccgcaccgcagagcccagacgaagaaagcgtccgcacgctgccgcgg
tcaaacccgtccaagacaccgagcgtctcctgggtgccgcccatcccgccgcccaaaccg
agccaaaaactccctcgtcaggcgttggcgccacaaggccttcccggccggccgcaataa

DBGET integrated database retrieval system