KEGG   Viruses: 11464110
Entry
11464110          CDS       T40000                                 

Gene name
UL36, AoHV-1_gp039
Definition
(RefSeq) Aotine betaherpesvirus 1; tegument protein vICA
  KO
K22788  Cytomegalovirus viral inhibitor of caspase-8-induced apoptosis
Taxonomy
TAX:50290
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Aotine betaherpesvirus 1)
SSDB
Motif
Pfam: US22
Other DBs
NCBI-GeneID: 11464110
NCBI-ProteinID: YP_004940062
RS: NC_016447
UniProt: G8XUB1
LinkDB
Position
NC_016447:complement(join(44144..45315,45410..45599))
AA seq 453 aa
MAAIEVLRHVASLHHDFSALDSFLESESGLRLPLEWPPECFIQLRSLAGLGYFEHKYDAV
CNKGRYVCCKEKMHPFGFVCHCARQWRYRYVLLLGASGSIYCYDDEEQCVYMVARSVEVL
CSRGLRNVDSFYAYTDLVPPGIECDEHIEQIIEVQDDLQSMAETVADIGCRVYPIIEPAG
IDTHFAIYTTGGLLYKTFTDNSVRNEALYVHVMGKATTQIACLCDVVGVLGCMSVENVFL
ARIFVLVDSFGVVYGYNDTFCRVSRLADNFEMFIRILGRKALQNYRYDSRKISVMRLEKP
PVCFHTVHDVLPEPQWDAVDNPFEPDREELCEADRFSAFLSSKRLMEDYNKHEATHELNC
VLIGNVTSGCFWAQEMKALTELPVHATSRTTNLSEARRYVLSLIDLSFEALCTKMESEDS
DEETITSFIFKKPCQKCVCRKRWRLFRAGRKEL
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcagccattgaagtgcttagacatgtggccagcctccaccacgacttctccgctctg
gacagttttctggagagcgagagcggcctgcggctccccctggagtggccgccggaatgc
tttatccaactgcgcagcctcgccggcctgggctacttcgaacacaagtatgacgctgtg
tgcaacaagggccgttacgtgtgctgcaaggagaagatgcatccgttcggcttcgtctgc
cattgtgccaggcaatggagataccgttacgttcttctcctgggggcctcgggcagcatc
tactgctacgacgacgaggagcagtgcgtgtacatggtggcccgcagcgtggaggttctc
tgctcgcggggactacggaacgtggattccttctacgcttacaccgacctggtcccgccc
ggcatcgagtgcgatgagcacatcgagcagatcatcgaggttcaagatgacctccagtcc
atggccgagacggtggcggacatcggctgccgcgtgtaccccatcatcgaaccggcgggt
atcgacacacacttcgccatctacaccaccggcggcttgttgtacaagaccttcactgac
aactcggttcgcaacgaggcgttgtacgttcacgtcatgggcaaggccaccacgcagatc
gcgtgtctgtgcgacgtggtgggtgtcctgggctgcatgtccgtggaaaacgtgttcctg
gccaggatctttgtgctcgtcgacagtttcggcgtggtgtacggctacaatgacacgttc
tgccgggtgtcgcgcctggccgacaacttcgagatgttcatccgaatcctggggaggaaa
gctctgcaaaactacagatacgactcgcggaaaatcagcgtgatgcgtttggagaagcct
cccgtgtgctttcacaccgtgcacgatgtgcttccggagccgcagtgggacgccgtggat
aatccttttgagcccgaccgcgaggagctctgcgaagccgaccgcttcagcgcgttcctg
tcgtccaaacggctcatggaggattacaacaagcacgaagccacccacgagctcaactgc
gtcctcatcgggaacgtcacttcgggctgcttctgggcacaggagatgaaggctctcacc
gagctgccggttcacgccacgtcgcggaccaccaacctctccgaggcgcggcggtacgtc
ctgtccctcatcgacctgtcgttcgaggccctgtgtaccaagatggagagcgaggactcg
gacgaggagaccatcacgtcgtttatcttcaagaagccgtgccagaagtgcgtctgcagg
aagagatggcgtttgttcagagcgggtcgtaaggagctgtga

DBGET integrated database retrieval system