KEGG   Viruses: 11464112
Entry
11464112          CDS       T40000                                 

Gene name
UL38, AoHV-1_gp041
Definition
(RefSeq) Aotine betaherpesvirus 1; protein UL38
  KO
K22776  Cytomegalovirus apoptosis inhibitor UL38
Taxonomy
TAX:50290
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Aotine betaherpesvirus 1)
SSDB
Motif
Pfam: US22 Glyco_transf_9 DUF3658
Other DBs
NCBI-GeneID: 11464112
NCBI-ProteinID: YP_004940064
RS: NC_016447
UniProt: G8XUB3
LinkDB
Position
NC_016447:complement(46965..47840)
AA seq 291 aa
MDCESHEWLQGSCANIGRLIQASILGKTALNAQIRRLMKAKAVLRHDSGLLVSICDITYD
LLILDHVKKAWLERSCASIIGQELIVFGVAEEWETASRYPSRQVVFLITPKWDVFVYQGG
ILFYLAPTMSDFWHCAIVMEYWNAVFPKPLYVHVRPYCHSMDDLLKVYHAYDLERQVMAA
RNEKCTRTGRKTFAKSVNGVIRSLLESYRSIEVGKIPSLFVERGSLYENANIQFFTHYLM
TKSKPPEDETHTEDGTTGPELPEQPCCSSTLSDTVRGAVGSCEPEQEPMMC
NT seq 876 nt   +upstreamnt  +downstreamnt
atggattgcgagtcgcacgagtggttgcagggctcgtgtgctaacattgggaggctgatt
caggcttctatcttgggtaaaaccgcactcaatgcgcagattaggaggctgatgaaggcc
aaggccgtactgcggcacgattcggggctgttggtttccatctgtgatatcacgtacgac
ctgcttatcctggaccacgtcaagaaggcttggttggaacgaagctgcgcctcgatcatc
ggtcaggaactgattgttttcggggtggcagaggaatgggaaaccgcctcgaggtaccca
agccgccaggtggtctttctcatcacccccaagtgggacgtgtttgtctaccaaggcggc
attcttttctacctggccccgaccatgtctgacttttggcactgcgctatcgtgatggaa
tactggaacgccgtgttccccaagccgctgtacgttcacgttagaccgtactgccacagt
atggatgacctgcttaaggtctatcacgcatacgacctggagagacaagtgatggcggcg
agaaatgaaaaatgtaccaggactggtaggaaaacctttgccaagagcgttaacggggtg
attagatccctgctggagtcgtaccggagcatcgaggttggaaagatacccagcctgttc
gtggagcgcggctcactgtacgaaaacgccaacatccagttctttactcactacctgatg
actaagtcaaagccccccgaagacgaaacgcacacggaggacggcactaccgggccggaa
ttgccggaacagccctgttgttctagcaccctgagcgatacggtgcgcggggcggtgggc
tcatgcgaacctgaacaggaacctatgatgtgctaa

DBGET integrated database retrieval system