KEGG   Viruses: 11464129Help
Entry
11464129          CDS       T40000                                 

Gene name
UL55, AoHV-1_gp059
Definition
(RefSeq) Aotine betaherpesvirus 1; envelope glycoprotein B
  KO
K22773  Betaherpesvirinae envelope glycoprotein B
Taxonomy
TAX:50290
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Taxonomy
Organism
vg  Viruses (Aotine betaherpesvirus 1)
SSDB OrthologParalogGFIT
Motif
Pfam: Glycoprotein_B Glycoprot_B_PH1 Glycoprot_B_PH2 TMEM171
Motif
Other DBs
NCBI-GeneID: 11464129
NCBI-ProteinID: YP_004940082
RS: NC_016447
UniProt: G8XUD1
LinkDB All DBs
Position
NC_016447:complement(74701..77352)
AA seq 883 aa AA seqDB search
MMMWKPLLYLGVFISLGWSSTTSSVTPSPSNATNSSTSAAGSNETVNVTTAKNATSPSPT
IFNTTLRENEVLSVNVTRFPYRICSMAQGTDIVRFAQNIECTPFNPQTDYQEGIMVVYKR
NIVAYTFNVTLYQKILTFQRSYKYVKSSYLLGKTVERHGLPLWEVNFVNIANRCYTSFSR
VINGETFVAYHKDNYQNDTMWLFEDDYSNTHNQRFVTVKEAWTTYGSVWMYKETCSMNCV
VTVTKGRSKYPYDYFALGNGDVVDISPFYNGSNGKTFRENADHFHLRRNYSRLGEFGTVH
TELVRHPLVAFFVRPDVTMSWMVEDENTSVCHFAFWDASNRVIRTENDNTYHFSSKEMTA
TFVTSKSVADPSKDGYQCIKDEAETKLERIFNTTYNGTYEKDGNVTMHVTNGGLVIFWQG
VKQKSIAELERVVNGNSSVVNATSKSSRRRRSTSNGTSPSNSSLPESEKNLLYAQVQFTY
DTLKNYINTALGHIVEAWCIDQRRTLEVFAELSKINPTRVLSAIYDRPVAAKFMGDVIGL
AQCVNINQTSVKVLRDMHVREGPMTGQCYGRPVVLYTFSNSTHVQYGQLGEHNEIFPGKH
RIERCEYPSVKIFIVGGVGYKYVDYYFKGLINLDSIEVVDTMIKLNIDPLENADFRMLEL
YTKDELRSANVFDLEDIMREFNAYKQRVRFVEKKVADDVPTYLRGLDDFMSGLGEVGKHL
GVAIGAVGGVVASFVEGFISFIKNPFGSLTALLFMLAVLGVIFLIYQRQRQTYEKPLQVL
FPYTSQGNEAPPSYESLYSDGKTPQAQEKTKDKAKTPKKTAAKYTEDDAREILDALIQYD
QQARQKLKKQTVEDVEEAKPTLLDTLRYRKSGYKQLKGYSENV
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgtggaagccgctcttgtacctaggtgtctttattagtttaggatggagctct
accacttcatctgtgacgccgtcaccgagcaatgccaccaactccagcacgagcgcggct
ggttccaacgaaacggtgaacgttacgaccgcgaaaaacgcaacgtcgcctagtcccacc
atctttaacaccactttgagggaaaatgaagttctatccgtcaacgttaccaggtttccg
taccgcatatgctcgatggcccagggcaccgatatcgtccgcttcgctcaaaatatcgag
tgtacgcctttcaatcctcagacggattatcaggagggtattatggtggtgtacaaaaga
aatattgtggcctacacgttcaacgtaacgttgtatcaaaagattctcacttttcagagg
agttacaaatacgtgaaaagtagctacttgttgggtaaaacggtggaacggcacggtttg
cctctttgggaggtgaattttgttaacatcgccaataggtgttacacctcgttttcgcgt
gtaatcaacggtgagacgtttgtggcttatcacaaagacaactatcaaaatgataccatg
tggctgtttgaggatgactattccaacacgcacaatcagaggttcgtcacggtgaaagaa
gcctggaccacgtacggatccgtatggatgtacaaggagacgtgcagcatgaactgcgtg
gtgaccgtcaccaaaggccgatctaagtatccgtacgattactttgcgctgggaaatgga
gacgtggtggacatttcgccgttttacaacgggagcaacggaaaaacgttcagagagaac
gccgatcacttccatcttagacgaaactattcaagactcggtgaatttggaaccgttcac
accgagctagttagacacccgttggtggctttctttgttagacccgatgtgaccatgtcg
tggatggtggaggatgagaacacgagcgtatgccactttgctttctgggacgcgtctaat
agagttatccgcactgagaacgataatacctaccacttttcgtccaaagagatgacggcc
acgtttgtgacctcgaaaagtgtcgccgatcccagtaaggatggctatcaatgcattaag
gatgaggccgaaaccaagttggaaagaatttttaacactacgtacaacggcacttacgaa
aaggatggtaatgtaactatgcacgttaccaacggagggctggttattttctggcaaggt
gtgaagcaaaaatctattgcggaattggagcgagtagtaaacggcaactcatctgtggta
aatgcaacgtccaagtcctctcggcgtcgtaggtccacaagtaacggaacgtcaccgtcc
aactcttccctgcctgaatcggagaaaaatcttttgtacgcccaagtgcagtttacctac
gatacgttgaaaaactacattaatacggcgttaggacatattgtggaagcctggtgtata
gatcagcggcgaacgttggaagtttttgctgaattaagtaaaatcaaccccaccagggtg
ttatccgccatttacgaccggccggtggcggccaagtttatgggggacgtgattgggttg
gcacaatgtgtgaatataaaccaaaccagtgtgaaagttcttcgtgacatgcatgtcagg
gagggtccgatgacgggacaatgttatggtagacctgtggttttatacacctttagcaac
agcactcatgtgcagtatggacagctgggggaacataacgagatttttcccgggaagcac
cgaattgagcggtgcgagtatcctagcgtcaagatatttatcgtcggaggcgttggatac
aagtacgtggattactatttcaaaggtcttatcaacctggatagcattgaagttgtggat
actatgataaaattgaacattgaccccttggaaaatgccgacttccgaatgttggaactg
tacaccaaagacgagctccgctctgccaacgtctttgacctggaggacattatgcgagag
ttcaacgcttacaagcagcgtgtgcggttcgtggagaagaaagtcgcggacgacgtgcct
acctaccttaggggcctggatgactttatgagcggcctgggtgaagtgggcaagcacctt
ggcgtcgctatcggggcggtaggtggcgttgttgcctcttttgtggaaggctttatctcc
ttcattaagaacccctttggctccctaacggcgttgttgttcatgctggcggttttaggc
gttatatttttgatttatcaacgtcagcggcaaacctacgaaaaaccgctgcaagtgtta
tttccctacacgtcccaaggtaacgaggccccgccttcgtacgagtcgctttatagcgac
ggtaaaacgcctcaggcgcaggaaaagaccaaggacaaagcaaagactcctaagaaaaca
gccgccaagtatactgaagatgatgcccgagaaatcttagacgccctcatccaatatgac
cagcaggctcgacaaaaactaaagaaacagacggtcgaggacgtggaggaagccaaacct
accttgttagacacgcttcggtaccgcaaaagcggctacaagcagctaaaagggtactct
gagaacgtctga

DBGET integrated database retrieval system