KEGG   Viruses: 11464146
Entry
11464146          CDS       T40000                                 

Gene name
UL83, AoHV-1_gp077
Definition
(RefSeq) Aotine betaherpesvirus 1; tegument protein pp65
  KO
K21045  Cytomegalovirus tegument protein UL83
Taxonomy
TAX:50290
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Aotine betaherpesvirus 1)
SSDB
Motif
Pfam: Herpes_UL82_83 Herpes_ORF11
Other DBs
NCBI-GeneID: 11464146
NCBI-ProteinID: YP_004940100
RS: NC_016447
UniProt: G8XUE9
LinkDB
Position
NC_016447:complement(106028..107665)
AA seq 545 aa
METRQGRRRHEAGEYVQTIGPISGHILKAIFNGADTLIKPQEMKQLSTGIDVKVAVPAVI
FASHFTPDSDRDHDRTGLTCQHTAFYSSEVKNLKVNVWNNSDRVQSTRKDPFSIYVYALP
LSPVKINQLYLFAASASDKKKLSCPVPEADTTIQKIGFQWSVRLVVSKLVWTRGRNETSN
FHTTCFVFDPLDIPIAQIDGGCDLVCSDDSCVITKLQLTRENKVKVYVESSKTEDPPSRL
FCHILLQKYDADIVMNRNPKPGMRQHGMNGLAILAPNKIIVKPGKVSHVCLDATFRCPGD
KNYIGLIVPKCLPGLGISSNFLHPGQHVFLELRVLGDGPVEIETGEELGNLHFVESSMIM
HKSPGFYSFVDQYHVEAKLEYDHVWDQARESSGVEGSGPSHRGGPMAAGLAAAYAAGPAD
DSDQDSSDDDYRAMKGECPRADTDDDSSDDDDERQPCQNAVLAWPCWKAGILTAHLPPIV
AQATGPRLKPHRFFWSENQTYRIFFQLIGEWSTVLQAKRRRQTAGSEPSASSLTVVPSVK
KRHRF
NT seq 1638 nt   +upstreamnt  +downstreamnt
atggagaccagacaagggcgtcgccgccatgaagccggggagtacgtgcagaccatcggc
cccatttccggccacatcctcaaggccattttcaacggcgcggacaccctcatcaaaccg
caagagatgaaacagctgagcaccggcattgacgtgaaagtcgccgtgcccgccgtcatt
tttgcgtcgcacttcacgccggactcggaccgcgaccacgatcgcacgggtttgacgtgc
caacacactgccttctacagctccgaggtcaagaatctgaaagttaacgtctggaacaac
agcgaccgggtgcaatccacgagaaaggacccgttctccatctatgtgtatgccctgcca
ctctcgcccgtgaagattaaccaactctatctgtttgccgcctcagccagcgacaagaaa
aaattgtcatgtcccgtgcccgaggccgacaccaccatccagaagatcggcttccaatgg
agcgtccgacttgtcgtgagcaagctcgtctggacgcggggccggaacgaaaccagcaac
tttcacaccacatgctttgtttttgacccgttggatatcccgatcgcgcaaatcgacggt
ggctgcgacctagtttgctcagacgattcgtgcgtcatcaccaaacttcagctaacgcgc
gaaaacaaagtcaaggtgtatgtcgagtcgtcaaagacagaagacccaccgagcaggctg
ttctgccacatcctgcttcagaagtatgacgcggatatcgtgatgaatcgcaaccccaag
cccggcatgagacagcacgggatgaacggcctggcgattctggcgcccaataagattatc
gtgaaacccggcaaagttagccacgtctgtctcgacgccactttccgatgccccggtgac
aagaactatatcgggcttatcgtccccaaatgcctacccgggttgggcatctccagcaat
ttccttcaccccggccagcacgtcttcctggaacttcgtgttttgggagatgggccggta
gaaatcgaaaccggagaagagttgggcaacctccacttcgttgaaagctccatgattatg
cacaagtcaccgggcttctactcgtttgttgatcagtatcacgtggaagccaaactcgaa
tacgaccacgtctgggaccaagcgcgggagagcagcggagtcgaaggcagcggtcccagc
catcgtggaggacccatggcagccggcttggctgccgcctacgccgccgggccggcggat
gattccgaccaagattcatccgacgacgattaccgcgcgatgaaaggcgagtgtccgcgt
gccgacaccgacgacgattcgtccgacgacgatgatgaacgacagccgtgccagaacgcc
gtcttggcctggccttgctggaaagcgggcatcctgacggcgcatctgccacccatcgtt
gcccaagccaccggcccgcgcctaaaaccgcaccgtttcttctggagcgagaaccaaacc
taccgtattttcttccaactcatcggagaatggagcacggtgctgcaggccaaacgacgt
cgacaaacggcgggctcggaaccctccgcatcgtcgttgaccgtagttccgtccgtcaag
aaacgacaccgtttctaa

DBGET integrated database retrieval system