KEGG   Viruses: 11464176
Entry
11464176          CDS       T40000                                 

Gene name
UL122, AoHV-1_gp107
Definition
(RefSeq) Aotine betaherpesvirus 1; regulatory protein IE2
  KO
K22775  Cytomegalovirus viral transcription factor IE2
Taxonomy
TAX:50290
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Aotine betaherpesvirus 1)
SSDB
Motif
Pfam: Herpes_IE2_3 Herpes_IE1
Other DBs
NCBI-GeneID: 11464176
NCBI-ProteinID: YP_004940130
RS: NC_016447
UniProt: G8XUH9
LinkDB
Position
NC_016447:complement(join(150924..152473,153893..154032,154152..154303))
AA seq 613 aa
MSDPKKFPGPASSPKRRHPQEEEDYEDPGEGTSSGTAAGPSTAPSLPKKLRPHEMNPVDA
AAQFLRRAIQDEIETQMSLGDPLFSVSGAPSQFMDKFGIDILAEAASAAGLIDEATGSTP
ITTSAVTSGVSSSSYSSSYSYYPHFEDTRTQARGPAPTAPPAALPTPAAPAAPTSPAPSE
EHSPRKKPRKSAVPVKFTPQDEEDGWDRRPIKIEYSPRPMRPHPTSCCIVITDSSDDEAA
AEAENEVGSEVQVQASQIAEAQESGAAQAEAQPSDTSDAAVRSVSGSISGSGSGSGYGAT
PLTSSERVEHSDPRHPDVLEKPKTPEATSSSSSSSSSESEDSDSSSESKPSTPSTPVPKK
RPQKKQQPSFEPLKVRSILKTKCTKFNVPATAAKRGRVKMGDIDRMFRATSRSLEYKHLP
FKAAGIHEVLERVIAKCKTMNTTKSMMMIHYTRTYNVKSAVEEMRAKLGMLCNLSISTPF
TFEHTAPKIHTPATVRNISQACENGVKGAWDVKEQHHHNLCPRSSDFRTIIVQAATPCDF
LQAVKECLPLVYKFPKQVCIRTAECDDGGNLLPIYDECSSGYALGHFQTPAPQPELESLT
QAIQKAIDDMDKH
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgtctgatccaaagaagtttccgggaccagcctccagtcccaagaggagacatccccaa
gaggaagaagactatgaagaccctggtgagggaacatcttccgggaccgctgcaggacct
tccacagcaccatccctacccaagaagctgaggccccatgagatgaatccagtggatgcg
gctgcccagttcctcaggagagccatccaggatgagattgagacccagatgtccttggga
gaccccctgttttcagtcagtggagccccaagtcaattcatggataaatttggtattgac
attttggctgaagcggcctcagctgctggcctcattgatgaggcaactggctccaccccc
atcaccaccagtgcagtcactagtggtgtcagctcatcttcttactcatcctcctactct
tactacccacactttgaggacaccagaacacaggccaggggccctgcccccacagcccct
ccagctgcccttccaacacctgcagccccagctgcccccacctcaccagcaccatcagag
gaacactcccctagaaagaagcccaggaagtcagcagtgccagttaagttcaccccccaa
gatgaagaagatgggtgggaccgcagacccattaagatagagtatagtccaaggcccatg
aggcctcatcccacctcatgctgtatagtgatcacagattcttctgatgatgaagcagca
gctgaggctgagaatgaggttgggtctgaagtgcaggtgcaggcttctcagatagctgag
gctcaggagtctggggcggctcaggctgaggctcagccctctgacacctcagatgccgct
gtgaggtctgtttctgggtctatctctggctccgggtccgggtctgggtatggtgccact
cctctcacatccagtgagcgtgtggagcactcagacccacgtcaccctgatgtccttgag
aagcccaaaacccctgaggccacgtcatcatcatcgtcatccagctcctcagagtcagag
gactctgattcttcttcagaatccaagccatctacaccctcaactcctgttcccaaaaag
aggcctcagaagaagcagcaaccctcttttgagccgctgaaggtaagaagcatcctgaaa
accaaatgcaccaagttcaatgtgccagccaccgctgccaaaagagggcgcgttaagatg
ggagacattgacaggatgttccgggccaccagcagatctttggaatacaagcacctgccc
tttaaagccgcaggcattcacgaggtcctggagagggttattgccaagtgcaagaccatg
aacaccaccaagtccatgatgatgatccactacaccagaacctataacgtgaagtctgcc
gtggaggaaatgagggctaagctgggcatgctgtgcaacttgagcatctcaaccccattc
acctttgaacataccgctcccaagattcacacgcccgccaccgtgcgtaacatctcccag
gcctgtgagaatggagttaagggggcttgggacgtgaaagagcaacaccatcacaacctg
tgtcccagatcatctgacttcaggaccatcatcgtgcaggccgccactccctgcgacttc
ttgcaggccgtcaaggagtgtctacctctggtgtacaagttccccaagcaggtgtgcatc
agaaccgccgagtgtgatgatggcggtaacctgctgcccatctatgatgagtgctcctcc
ggctatgctctgggacactttcagaccccagctcctcaaccagagctggaaagcctaacc
caggccatccagaaggccattgatgatatggataagcactga

DBGET integrated database retrieval system