KEGG   Viruses: 11464264
Entry
11464264          CDS       T40000                                 

Gene name
UL33, SaHV-3_gp029
Definition
(RefSeq) Saimiriine betaherpesvirus 4; envelope glycoprotein UL33
  KO
K22782  Cytomegalovirus G-protein coupled receptor UL33
Taxonomy
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Saimiriine betaherpesvirus 4)
SSDB
Motif
Pfam: 7tm_1 Peptidase_M48_N
Other DBs
NCBI-GeneID: 11464264
NCBI-ProteinID: YP_004940205
RS: NC_016448
UniProt: G8XSU7
LinkDB
Position
NC_016448:join(34008..34043,34124..35323)
AA seq 411 aa
MEILLETPNNTAVYTEDYLHINDSCGTTASLQMARYAEALINTFIILIGAPLNCIVLITQ
MLSNRVHGYSTPALYMTNLSSANLITLMVLPFIVLGNRGYLPGTVQTCKFISLAYYSSCT
VGFATVALIAADRYRVLHRKTHRRSSYTKTYVILATTWMISLICAAPASLYTTVVVHDDK
IGIGEQTCVLFFEQDQIYTILLCFKILITLIWGITPIAMMTWFYTFFYTTLKRASYHKRN
RTVTFISLLLLSFLFIQTPYVIIMLFDGIAMMHWPLECQYLSHRKVIATMAKLVPNFHCL
INPILYAFLGNNFLQRLKQCVRGELFDRRAFLRSRQNSAARASNPTRRPSASPLVPTGTP
PSNGTENASPRDTETVPNFSSQAAALLSSPPPPPKPSTKPRNLIKETPPET
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggaaattttactggaaactcctaacaacaccgcggtgtacaccgaagattacttgcac
atcaacgactcatgcggtactacggcttctttacagatggctcgttacgccgaagctctc
atcaacacctttatcattctcatcggcgcaccactcaactgcattgtcttaattacccag
atgctttccaatcgagtccacggatactcaacccccgctctttacatgacgaatctttct
tcggccaacttaatcaccctcatggttctacctttcatcgtgttgggaaatcgcggatac
ttacccggtaccgtccaaacctgcaaattcatctctctcgcttactactccagttgcaca
gtcggatttgcaactgtagccctgatcgccgccgaccgatatcgcgtcctccaccgaaaa
acccacagacgttcatcatacaccaaaacctatgtcattctagccaccacctggatgatc
tctctgatctgcgccgcacccgcctcgctttacactaccgtcgtggtccatgacgataaa
ataggaatcggagagcagacatgcgttctttttttcgaacaagatcagatctacaccatc
ctactgtgttttaaaatcctcatcaccctaatctggggaatcaccccgatcgctatgatg
acatggttctacacttttttctacacgaccctgaaaagagcctcctaccacaaaagaaac
cgaacggtcactttcatcagcttgctgcttctatcctttctcttcatccagactccctat
gtgatcatcatgctgttcgacggaatcgccatgatgcattggcctttggaatgtcaatat
ctgagccacaggaaagtcatcgctaccatggcaaagttagttcccaactttcattgtctc
atcaaccccatcctctacgcttttctcggcaataactttctccagaggttaaaacaatgc
gttcgaggggaactgtttgaccgccgagcttttttgcgttctagacaaaactcggccgcc
agagctagcaatccaacccgcagaccatcggcttcgcctctcgtacccacaggcacacca
ccatccaacggaactgagaacgcatcaccacgcgacaccgaaactgttccaaacttctcc
agccaggcggcagcattactaagttccccaccaccgccacccaaacccagcaccaagcct
agaaatctcatcaaggaaactcctcctgaaacctaa

DBGET integrated database retrieval system