KEGG   Viruses: 11464267
Entry
11464267          CDS       T40000                                 

Gene name
UL36, SaHV-3_gp032
Definition
(RefSeq) Saimiriine betaherpesvirus 4; tegument protein vICA
  KO
K22788  Cytomegalovirus viral inhibitor of caspase-8-induced apoptosis
Taxonomy
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Saimiriine betaherpesvirus 4)
SSDB
Motif
Pfam: US22
Other DBs
NCBI-GeneID: 11464267
NCBI-ProteinID: YP_004940208
RS: NC_016448
UniProt: G8XSV0
LinkDB
Position
NC_016448:complement(join(38374..39542,39623..39830))
AA seq 458 aa
MLCVRMAAATEEYRRIASFRGDFEALQRYLETESGSRILVSWPPGCFIQLRNLSGLGYFE
SRFEDVCNKGLYVCCGEKLYPFGFVCHRTKQWRYRFIVLLGETGSVYCYDYDEDGVFLVA
RDVEMLVSEGLRNVDGFYGFSDLVLPAIQCDEYIARLVEVQHNLQAFSRVVEDVGCRMYK
VTGHSVIDTHFAIYSTEGMTIQMLTDSTSDRDRLYMYVMSKSAAQIACICDIIGVLGSVS
TENVFVVRLFILIDCFGVVYGYNDVFNSVSRLADSFEMFIRILGAKATRNYRYSSRKSAV
MRLEKPPICFHLLQNILPESLLDAVDKVFDLKESELCEADRFASFVSFKEVVERHNVYEA
IYKINCVIHENATSRYFWAQELMALAESSVLVKCVRDHVAARQYFLSLTDPSFELLCTKM
ENEESEDETLAEFIFDKPCLKCVFRKRWRVFRAGRKEL
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgttgtgtgtgaggatggctgcagcgaccgaggagtatcggcgcattgcaagttttcgt
ggggattttgaggcgcttcaaagatacttggaaacagaaagtggttctcggattctggtg
tcttggcctcctggctgcttcatacagcttcgcaatctttctggcttgggatatttcgaa
tcaaggttcgaagatgtgtgcaacaaaggcttgtatgtgtgctgcggtgaaaaactgtat
cctttcggcttcgtgtgtcaccgaactaagcagtggaggtaccgtttcatcgttctcctg
ggagagactggcagtgtctattgctatgactacgacgaagacggtgtgtttctcgtggct
cgagatgtggaaatgttggtctctgagggtcttcgaaacgtcgatggattctacggtttt
tcggatttagtattgcctgctatccagtgtgatgagtatattgcacgtttagttgaagtg
cagcataatctccaagcgttttctcgtgtggtggaggatgtggggtgtcggatgtataag
gttacagggcattcggtaatcgacactcacttcgcaatttatagtacagagggtatgacg
attcaaatgttgaccgattcgacttctgatcgtgacaggttgtacatgtatgtcatgagc
aagtctgcagcccaaatcgcgtgcatctgtgacatcatcggagtgttgggttctgtctct
acggaaaatgtctttgtagtcagattgttcattctcatagattgttttggtgtcgtgtat
ggttacaacgacgtgtttaacagtgtctcgcgtctggctgatagttttgagatgtttatc
agaatcttgggggctaaagcgacaagaaattatagatattctagtcgcaagtccgccgtg
atgcggctggagaaaccacctatttgttttcatctgcttcagaatattctgccggagtct
ttactagatgctgtcgataaagtcttcgatctgaaagagagtgaattatgtgaagctgat
cgattcgcttcttttgtctcgttcaaagaggtagtggagcgtcataatgtgtatgaagcc
atctataagatcaattgtgtcatacatgaaaacgcgacgtcgcgttatttctgggcacaa
gaattaatggcgttggcagaatcttcggtattggtaaaatgtgttagagatcatgtggcg
gcgcgacagtattttttgtctctcaccgatccttcgtttgaactcttgtgcaccaagatg
gaaaacgaagaatcggaagacgagactttggctgaatttatttttgacaaaccatgtttg
aaatgtgtatttcgaaaaaggtggcgtgttttcagggcgggccgaaaagagttgtaa

DBGET integrated database retrieval system