KEGG   Viruses: 11464286Help
Entry
11464286          CDS       T40000                                 

Gene name
UL55, SaHV-3_gp052
Definition
(RefSeq) Saimiriine betaherpesvirus 4; envelope glycoprotein B
  KO
K22773  Betaherpesvirinae envelope glycoprotein B
Taxonomy
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Taxonomy
Organism
vg  Viruses (Saimiriine betaherpesvirus 4)
SSDB OrthologParalogGFIT
Motif
Pfam: Glycoprotein_B Glycoprot_B_PH1 Glycoprot_B_PH2
Motif
Other DBs
NCBI-GeneID: 11464286
NCBI-ProteinID: YP_004940228
RS: NC_016448
UniProt: G8XSX0
LinkDB All DBs
Position
NC_016448:complement(67895..70546)
AA seq 883 aa AA seqDB search
MWKVFLYLSVFINFRYGVSSNTTSAPVSESSNRSTSSVMTSGTSRVSRSSGSVSASSSSV
AANVTSTPIPKTIFNTTLRENEVLSVNTSKYPYRICSMAQGTDIVRFAKNIKCTPFNPNT
DFEEGIMVVYKRNIVTHTFKVILYQKVMTFQRSYRYVYSTYLLGNTVERVAVPMWEVHYV
DRASRCYTSYTRVMNGNTYVLYHQDNHQNDTMWLVEDDYSNSHNRRYVTVKEVWTTYGSA
WMYKETCSLNCVVTITMARSRYPYDFFVLTSGDIVDISPFYDGTNGKSFKENADKFYIRR
NYTKLTYYGDSNAPWETYDKVAFFQRSDVSMSWVITDENKTVCQYKFWDSSDRTIRTEGS
DTYHFSSQELTATFVASKNDVSENGQKSEYQCIQDEARQKLERIYNQTYNSTYEKKGNVT
MHITTGGLIVFWQGVTQKSIASLERLINNASEANSSTTSRRKRSADSSNSSSSDSERSLL
YSQVQFTYDTLKNYINNALGHLVEAWCIDQRRTLEVFAELSKVNPTRIMSAIYDKPVAAK
FMGDVIGIAKCVLINQTSVKVLRDMHVLDGPMKGQCYARPVLLYTFVNSSHVQYGQLGED
NEVLVGRHRTELCEYPSVKVFIVGDVGYKYVDYYFKGLINLDSIEIVDTMIRLNIEPLEN
TDFRMLELYSKDELRSANVFDLEEIMREFNSYKQRMRFVEDKVADNIPPYLRGLDDFMSG
LGEAGKHLGVAIGAVGGAVASVMEGIGSFLKNPFGSFTVLLFLLAVLGVIFLIYQRQKRT
YEKPLEVLFPYTSQMIKEAPPPYSPPPYTDVSKPSSKNQLSSEEDDKYSPEDAKAILKAL
MKYDEQERRNLKRVSEEGSEGGTGILDALRYRSRGYNRLVSED
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaggtgtttttgtacctaagtgtctttattaactttagatatggagtgtcgtct
aacacgacctcggcgccggtttcagaatcatcaaatcgttccaccagttctgttatgact
agtggaactagtcgagttagcagatcgtccggttccgtttcggcgtcgtcatccagtgta
gcagcgaacgtgacttcgacgccaattcccaaaaccatttttaacacgaccttaagagaa
aatgaggtgttatctgttaatactagcaagtatccgtatcgtatctgttctatggcacag
ggaactgatattgtaagatttgctaagaatattaagtgtacgccgtttaatccaaatact
gatttcgaggagggtattatggttgtgtataagaggaatattgtcactcatacttttaaa
gtaattttgtatcagaaagttatgactttccagagaagttacagatatgtgtatagtaca
tatctgttaggaaacactgtagaacgtgttgctgtacccatgtgggaggtccattatgta
gaccgtgcgagtcggtgttacacttcttatacacgcgttatgaatggtaatacctatgtt
ttatatcatcaagataatcatcagaacgacaccatgtggttagtagaagatgattactcg
aattcgcataatcgaagatatgtgacggtgaaagaggtctggacgacgtatgggtctgct
tggatgtataaggaaacgtgtagtttaaactgtgttgtgactattacgatggcaaggtct
agatatccgtatgattttttcgttctcaccagtggagatattgtcgacatatcgccgttt
tatgacggaacgaacggcaagtcttttaaagagaatgcggataaattttatatcaggcgg
aattacacgaaacttacttattatggtgattcaaacgcaccatgggagacatatgacaaa
gttgcgttttttcaaaggtctgatgtttccatgtcgtgggtcatcaccgatgaaaacaag
actgtgtgtcagtataagttttgggattcatcagatagaaccattagaacggagggttct
gatacttatcatttttcctcgcaagaattgacagcgacgtttgtagcttctaaaaatgat
gtgtcagaaaatgggcagaaaagcgagtatcaatgtattcaggatgaagccaggcaaaag
ttggagagaatatataatcagacgtacaacagtacgtatgagaaaaaaggtaacgtgacg
atgcatataactacagggggattgatagtattctggcagggtgttacgcagaagtctatc
gcttcgctggagaggttgatcaataatgcctccgaagctaacagcagcaccacgagtcgt
cggaaacgatctgcggattcgtcgaattcgtcttcatctgattcagagcgtagtctttta
tattcgcaggttcaatttacatatgatacactgaagaattatattaataatgcgttaggt
catcttgtggaggcttggtgtatagatcagcggcgaacattggaggtttttgccgagttg
agtaaagtaaatcctacaaggattatgtcggcgatttatgacaaacctgtcgcggctaaa
tttatgggtgatgtcataggaattgctaaatgtgtgctgattaatcagacgagtgttaag
gttttacgagatatgcatgtcttagacggtccgatgaaagggcagtgttatgctagacct
gttctgttatacacgtttgtcaatagttctcacgtgcagtatggtcagttaggtgaagat
aatgaagtcctggtaggcaggcatagaactgaattatgtgaatatcctagtgtaaaagtc
ttcattgtaggtgatgtagggtataagtatgtagattattattttaagggattgatcaat
ctagatagtatagaaatagtagacactatgattcgattaaacatcgagcctttagagaat
acagattttcggatgttggagttatattctaaggatgaacttcgatctgctaatgtcttt
gatctggaggagattatgagagaatttaattcttataaacaacgtatgaggttcgttgag
gacaaggtagctgataatatccctccatatctgcgagggttggatgattttatgagcggt
ctaggggaagctgggaaacatttgggtgttgccataggggcggtaggtggcgccgttgcc
tctgtaatggaaggtattgggtcgttcttgaaaaatccttttggatcgttcacggtatta
cttttcctactagcggttttaggcgttatatttttgatttatcagaggcagaaacgcact
tacgaaaaaccgttagaagtattgtttccttacacgtcgcagatgatcaaagaggctccg
cctccgtatagtcctccgccttatacggatgtgtcgaagccttcgtctaaaaatcagctt
tcgtcagaggaagatgataaatacagtccagaagatgctaaagctattctaaaagctctc
atgaagtacgatgaacaggagagacggaatctgaaaagggtatctgaagaaggttcggaa
ggtggaactggtattctggatgcacttcgttatcgttctaggggttataaccgtctagtg
tctgaagattga

DBGET integrated database retrieval system