KEGG   Viruses: 11464304
Entry
11464304          CDS       T40000                                 

Gene name
UL83, SaHV-3_gp071
Definition
(RefSeq) Saimiriine betaherpesvirus 4; tegument protein pp65
  KO
K21045  Cytomegalovirus tegument protein UL83
Taxonomy
  Lineage
Viruses; dsDNA viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Saimiriine betaherpesvirus 4)
SSDB
Motif
Pfam: Herpes_UL82_83
Other DBs
NCBI-GeneID: 11464304
NCBI-ProteinID: YP_004940246
RS: NC_016448
UniProt: G8XSY8
LinkDB
Position
NC_016448:complement(96423..98000)
AA seq 525 aa
METRLTRRRHQAGDLVNKIGPISGHVIKCIFNGTDTKLQARETRMLSTGVHVRVNVPAII
FATHFTADSERDHDWRGLKSQHTAFYSTEIQNIQVAVTNTSDRVQSTNTDPFSIYVYALP
LKVVTISGLHVYRPSSEKKTRSSIPEADVIVQRVASHWSVRMTVTQLIWTSNRNDDTEQR
HSSCFILDPHGIPFEDFDSVTDLVCSDEAVILTKVQALTSEKKLRIYLECPKEEDQLPTR
LFCHLLLENKNPDIIMNRNPKPFLRPYGTNGFVIMAPRNIIVKPGKTSHVCLDMTFRCLG
IDYIGLIVPKSLPNLSISSNFLRSSQHLFLEIQTTGETAVEIPKGEDIAALHFFESHIFL
HKNDQFYTFTGQYDVECKLEYDHVWDDIQDAIHTSAVSAVTGPEDSGDESDDPFKSATTG
EKPRHDSDEDNSDEEDTGASKNAVLTWPCWKAGTYTCHLPPLIARAYGPNLKKHDFYWSE
NPTYRIFFGLSGEWGPPISGKRRRPTAESSSLTVVPSTSKKRHRF
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggagaccagactcactcgtcgacggcatcaagccggcgacctagttaataagatcggt
ccaatttccggacatgtgataaaatgcatattcaatggtaccgacaccaaattacaagct
cgagaaaccagaatgttaagcaccggtgtacacgtcagagttaacgtgcccgccatcata
tttgccacccacttcaccgccgattccgaacgtgatcacgactggcgaggcctcaagagt
caacatacggccttttacagcacagagatacaaaatatccaagtagctgtcaccaatacc
agcgaccgagtccaatccaccaacacagaccctttctccatttacgtctacgctctccca
ctcaaggtcgtcactataagcggcctacatgtttatcgaccctcaagtgaaaaaaagact
cgatcctctattcccgaagccgatgtcatagttcaacgtgtcgcctcacactggagcgta
agaatgacagtcacccaactcatatggacaagcaaccggaatgacgacacagagcaaaga
cacagttcatgctttattttggatccacacggaattcctttcgaagactttgacagtgtg
accgatctcgtctgttccgacgaagcggtcatcttgactaaagtccaagccctcacatct
gaaaagaaacttcgcatctacctggaatgtcccaaagaagaagaccaactgcccaccaga
ttattctgccatctgctactcgagaacaaaaaccctgacattatcatgaaccgaaacccc
aaaccctttctccgaccctacggcacaaacggtttcgtgatcatggcccctcgcaacatt
atagtgaaaccaggaaaaaccagtcacgtatgtctagacatgactttccgatgcctaggt
atagactatatcggattaatcgtaccgaaatcgcttccgaacctcagcatttcgagcaac
ttcttacgaagtagtcagcatctttttctagaaattcaaacgactggagagaccgccgtc
gagataccaaaaggcgaagacatcgccgcactccacttctttgagagccatatttttctc
cacaaaaatgaccaattctatacatttaccggtcaatacgatgtcgaatgtaagttagaa
tacgaccatgtttgggacgatattcaagacgctatccatactagtgccgtcagcgccgta
accggcccagaagattcaggagatgaatccgatgatcccttcaagtcggccacgaccgga
gaaaagccacgtcacgactctgatgaagacaactccgatgaagaagatacaggagcatcc
aaaaacgccgtactcacctggccctgctggaaagccggaacctacacttgccaccttcca
cccttaatcgccagagcctacggacctaatctaaaaaaacatgacttttattggagtgaa
aatccgacatatcggattttttttggtctttccggagaatggggcccaccgatttccggg
aaacgacgtcgacccaccgcggaatcaagctcgctgaccgtagttccctctaccagtaaa
aaacgacaccgcttctaa

DBGET integrated database retrieval system