KEGG   Viruses: 11464334
Entry
11464334          CDS       T40000                                 

Gene name
UL122, SaHV-3_gp101
Definition
(RefSeq) Saimiriine betaherpesvirus 4; regulatory protein IE2
  KO
K22775  Cytomegalovirus viral transcription factor IE2
Taxonomy
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Saimiriine betaherpesvirus 4)
SSDB
Motif
Pfam: Herpes_IE2_3 Herpes_IE1 CCDC106 SR-25
Other DBs
NCBI-GeneID: 11464334
NCBI-ProteinID: YP_004940276
RS: NC_016448
UniProt: G8XT18
LinkDB
Position
NC_016448:complement(join(137643..138889,140225..140367,140457..140554))
AA seq 495 aa
MAANPPPKRPHDDDDPGEGTSSGPSPPKQPKIFQPEDPVTIARRFIQKTLNEEVKTQLSL
GDPLFPVADNTDDDPFKECLGGIDILAEAASMAGILDSSSTNTPGIIKSSSSIINPIHST
PSPDAPYTPSPPFPEDQSPRKRPRKSTPMKMPPEWLPMKVEYNPQPITTPTSSCIVISDS
DEEHEDSGDVNAPVCTESVECHSESLVVGKPQSPCTSSSSSSSSSESDSDTSESKNSPTA
PPATKKKRPGKKQQPSFEPAKVRSILKTRMAFDKPTGPAKRGRVKMSDISRMFRATTRSL
EYKNLPFKPTPMNEVLESAIAKCKTMNTTRAMFMIHYTRTYNVKSAIEDVRAQLGMICNL
SISSPFTLEHTAPMVHSPSTVRNVSKACEDGVKGVWDLKEDHTHQLCPRSSDYRTIMVHA
ATPADYLQAIKVCLPLLHKYPRQVCIRTADLNKGENMLPIYDDCSSAYVVGQFQTGNDDM
DTLNQAVQKAIEDLE
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggctgctaacccaccacctaagagaccacatgatgacgacgacccaggagaaggaact
tcttcaggaccatctccacccaaacaacctaagatattccagcctgaggatccggtgacg
attgccagaagatttatccagaaaacccttaatgaagaggtcaaaacacaactgtctctt
ggagaccctctctttcctgttgcagacaacacagatgatgatccatttaaagaatgcctt
ggaggcattgacattctggcagaagcggcatcaatggcgggtatcttagactcttcctcc
actaacacacctggtatcatcaaatcatcatcctcaatcatcaaccccattcattccacc
ccttccccagatgccccttacactccatcacctccatttccggaggatcagtcacccaga
aaaagacctagaaaatctacccctatgaaaatgccccctgaatggctacctatgaaggta
gaatacaacccacaacccatcactacacccacctcatcttgtatcgtgatctccgactct
gatgaagagcatgaagatagtggagatgttaacgctcctgtctgtacagagagtgtggag
tgtcactcagaaagtcttgtagttggtaagcctcaatcaccgtgcacgtcatcatcttcg
tcatccagctcttcagaatcagattctgatacctcagagtccaaaaactccccgactgca
ccacctgcgaccaagaaaaagagacccggcaaaaaacaacaaccttcatttgaaccagca
aaagtgcgaagcatcctaaaaaccaggatggcattcgacaaaccaacgggtcccgcgaaa
agaggtagagtgaagatgtcagatatctctagaatgtttagagcgaccaccaggtcattg
gagtataaaaatttaccttttaaacctacaccgatgaacgaggtcctcgagagcgctatc
gctaaatgcaagaccatgaacaccaccagggccatgtttatgattcactacaccagaaca
tacaacgtgaaatcagcaatcgaagacgtccgagcacaacttggtatgatatgcaacctg
agcatttcatcaccctttacccttgaacataccgcacccatggttcattctcctagtacc
gtccgtaacgtgtcaaaggcctgtgaggatggagtcaaaggtgtttgggatctgaaagag
gaccacactcaccagttatgccccaggtcttctgactacagaaccatcatggtccatgca
gccacacccgctgattaccttcaggccatcaaagtttgcttaccgcttcttcacaagtac
cccagacaggtctgtatcagaaccgctgatttaaacaagggggaaaacatgctacccatc
tatgatgactgttcttctgcatatgtagtgggccagttccaaactggtaatgatgatatg
gacaccttgaatcaggcagttcaaaaagctattgaagacctagaataa

DBGET integrated database retrieval system