KEGG   Viruses: 1261342
Entry
1261342           CDS       T40000                                 
Symbol
yosJ, SPBc2p157
Name
(RefSeq) Bacillus virus SPbeta; hypothetical protein
Taxonomy
TAX:66797
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Spbetavirus
Organism
vg  Viruses (Spbetavirus SPbeta)
SSDB
Motif
Pfam: DUF4371 DUF982
Other DBs
NCBI-GeneID: 1261342
NCBI-ProteinID: NP_046709
RS: NC_001884
UniProt: O64169
LinkDB
Position
NC_001884:119595..119789
AA seq 64 aa
MIQGFYKDQKLHLLEDPMQQYTVMKVEENAVCVYRWIDDYRHKIERFTDVEEAKKLLGEG
WPKQ
NT seq 195 nt   +upstreamnt  +downstreamnt
atgattcaagggttttataaagatcagaaacttcatcttctagaagatcctatgcagcag
tacaccgtcatgaaagttgaagaaaatgcagtatgtgtttaccggtggatcgatgattat
agacacaagattgaaagattcacagatgttgaagaggctaaaaaactccttggagaaggg
tggccgaaacaatag

DBGET integrated database retrieval system